DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and pafah1b3

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001006715.1 Gene:pafah1b3 / 448360 XenbaseID:XB-GENE-485956 Length:226 Species:Xenopus tropicalis


Alignment Length:116 Identity:26/116 - (22%)
Similarity:45/116 - (38%) Gaps:36/116 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 TLRQG-SIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLGK-VAPIRLPT--V 150
            |..|| |..:.:||.:..|:.||:.....:..:   :||         ||.|| ..|:|...  |
 Frog   104 TYNQGHSAEQIAGGILAIVRCIYQRQPQAKVIV---MAL---------LPRGKNPNPLRNRNLQV 156

  Fly   151 GEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHND--LRHH 199
            .:.:.|::|:                  |.:..:|..:....|:|  :.||
 Frog   157 NKLLEETLPS------------------LPNAFLLDADPGFVHSDGTISHH 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 26/116 (22%)
Tryp_SPc 37..263 CDD:238113 26/116 (22%)
pafah1b3NP_001006715.1 PAF_acetylesterase_like 8..217 CDD:238858 26/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.