DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG7432

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:303 Identity:89/303 - (29%)
Similarity:134/303 - (44%) Gaps:63/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AGILVILE------ASRTEAAVPRQPD----------------------SRIVNGREATEGQFPY 50
            :|:::|.:      .:.|...||.:|:                      .|||.|.||..||:|:
  Fly   424 SGLVLIPQKKPPTTTTTTTTEVPLEPEGLDEIGNNIVDPDECGQQEYSTGRIVGGVEAPNGQWPW 488

  Fly    51 QLSL----RRQTVHICGASILSSNWAITAAHCIDGHEQQP---REFTLRQGSI-MRTSGGTVQP- 106
            ..::    .::|...||.|::.:.:.:|||||.....|:|   |:||:|.|.| :.|......| 
  Fly   489 MAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRLGDIDLSTDAEPSDPV 553

  Fly   107 ---VKAIYKHPAYDRADMNFDVALLRTADGALSLPLGK---VAPIRLPT-VGEAISESMP---AV 161
               ||.:..|..:.|.....|:|:|     .|..|:.|   |.|:.||. :.....|.:|   |.
  Fly   554 TFAVKEVRTHERFSRIGFYNDIAIL-----VLDKPVRKSKYVIPVCLPKGIRMPPKERLPGRRAT 613

  Fly   162 VSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAARN--TDACQGDSGGP 224
            |.|||.........:|..::...:..| |.|  |..:...:.|...||...:  .||||||||||
  Fly   614 VVGWGTTYYGGKESTSQRQAELPIWRN-EDC--DRSYFQPINENFICAGYSDGGVDACQGDSGGP 675

  Fly   225 I----SAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
            :    .:....:|:||:|..|.:|.|||||||:..  ...|||
  Fly   676 LMMRYDSHWVQLGVVSFGNKCGEPGYPGVYTRVTE--YLDWIR 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 80/250 (32%)
Tryp_SPc 37..263 CDD:238113 80/250 (32%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 80/250 (32%)
Tryp_SPc 475..718 CDD:238113 82/252 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.