DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG6592

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:280 Identity:75/280 - (26%)
Similarity:125/280 - (44%) Gaps:46/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PFLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSL---RRQTVHICGASILSSN 70
            |.:|......::|....|.|:..   .||..|.......||||:.:   |.:.::.||.|::|..
  Fly    98 PLVLNLETTPLMEKMLPEGAMAM---DRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDK 159

  Fly    71 WAITAAHCIDGHEQQPREFTLRQGSIMRTS--GGTVQ---PVKAIYKHPAYDRADMNFDVALLRT 130
            ..||||||:|   ...|.......:.::.:  .|.|:   |.:....:|.::...:..|:|::| 
  Fly   160 HVITAAHCVD---MAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVR- 220

  Fly   131 ADGALSLPLG-----KVAPIRLPT--VGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVN 188
                  ||..     ::.||:||.  ......::..|:.||||..:|....:|:||:...:..::
  Fly   221 ------LPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIID 279

  Fly   189 QEKCHND--LRHHGGVTEAMFCAAARNT-DACQGDSGGPI------SAQGTLIGIVSWG--VGCA 242
            ...|.::  |.:.|    ...|.:.||. ..|.||||||:      |.:..|:||.|:|  .|| 
  Fly   280 GRTCKSNFPLSYRG----TNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGC- 339

  Fly   243 DPYYPGVYTRLAHPTIRRWI 262
            |..||..:|::|  :...||
  Fly   340 DRGYPAAFTKVA--SYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 68/251 (27%)
Tryp_SPc 37..263 CDD:238113 69/252 (27%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 68/251 (27%)
Tryp_SPc 123..359 CDD:238113 69/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.