DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG32260

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:262 Identity:81/262 - (30%)
Similarity:127/262 - (48%) Gaps:49/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SRIVNGREATEGQFPYQLSL-------RRQTVHICGASILSSNWAITAAHCID---------GHE 83
            :|:|.|.||.:|.:|:..:|       |.....:||.|::.|.:.||:||||:         .|:
  Fly   326 NRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCINPMLTLVRLGAHD 390

  Fly    84 -QQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLR-TADGALSLPLGKVAPIR 146
             .||.|           ||.....::....|..:|...::.|:||:. ...|||.   |.::||.
  Fly   391 LSQPAE-----------SGAMDLRIRRTVVHEHFDLNSISNDIALIELNVVGALP---GNISPIC 441

  Fly   147 LPTVGEAISE---SMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKC---HNDLRHHGGVTEA 205
            ||...:.:.:   .|...|:|||.:.... |.|.||:...|..|::..|   :..:......::.
  Fly   442 LPEAAKFMQQDFVGMNPFVAGWGAVKHQG-VTSQVLRDAQVPIVSRHSCEQSYKSIFQFVQFSDK 505

  Fly   206 MFCAAARNTDACQGDSGGPI---SAQGT-----LIGIVSWGVGCADPYYPGVYTRLAH--PTIRR 260
            :.||.:.:.||||||||||:   ..:|.     |:|:||:|..||.|.:||||||:|.  |.|::
  Fly   506 VLCAGSSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARPNFPGVYTRVASYVPWIKK 570

  Fly   261 WI 262
            .|
  Fly   571 HI 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 80/259 (31%)
Tryp_SPc 37..263 CDD:238113 80/260 (31%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 79/255 (31%)
Tryp_SPc 328..571 CDD:238113 79/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.