| Sequence 1: | NP_001036717.1 | Gene: | CG10405 / 41996 | FlyBaseID: | FBgn0038431 | Length: | 268 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_955403.2 | Gene: | Prss30 / 287106 | RGDID: | 735142 | Length: | 304 | Species: | Rattus norvegicus |
| Alignment Length: | 279 | Identity: | 94/279 - (33%) |
|---|---|---|---|
| Similarity: | 140/279 - (50%) | Gaps: | 45/279 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 FLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTV-HICGASILSSNWAI 73
Fly 74 TAAHCIDGHEQQPRE---FTLRQGSI---MRTSGGTVQPVKAIYKHPAYDRADMNF-DVALLRTA 131
Fly 132 DGALSLPL--GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHN 194
Fly 195 DLRHHGGVTEA---------MFCA--AARNTDACQGDSGGP----ISAQGTLIGIVSWGVGCADP 244
Fly 245 YYPGVYTRLAHPTIRRWIR 263 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10405 | NP_001036717.1 | Tryp_SPc | 36..262 | CDD:214473 | 85/250 (34%) |
| Tryp_SPc | 37..263 | CDD:238113 | 86/250 (34%) | ||
| Prss30 | NP_955403.2 | None | |||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100031 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||