DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG30289

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:220 Identity:61/220 - (27%)
Similarity:104/220 - (47%) Gaps:32/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGASILSSNWAITAAHCI----------DGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAY 116
            ||.|:::..:.:|||||:          |.....|..:.|....|.:....:|. :|.:  |..|
  Fly    65 CGGSLIARQFVLTAAHCVSFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVD-MKIV--HENY 126

  Fly   117 DRADMNFDVALLRTADGALSLPLGKVAPIRLPTVGEAISESMPA-VVSGWGHMSTSNPVLSSVLK 180
            :...:..|:||||.::.......  |.||.| .|||.: :|:|. .|:|||  .|.....|.:|.
  Fly   127 NGITLQNDIALLRMSEAVEYSDY--VRPICL-LVGEQM-QSIPMFTVTGWG--ETEYGQFSRILL 185

  Fly   181 STTVLTVNQEKCHNDLRHHGGVTEAMFCAAARNTDACQGDSGGPISAQ---GTLI-----GIVSW 237
            :.|:..::...|  :::.:.....:..||.:..::.|:||||||:|::   |..:     |:||:
  Fly   186 NATLYNMDISYC--NIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSY 248

  Fly   238 GVGCADPYYPGVYTRLAHPTIRRWI 262
            |.........||||.:::.  |.||
  Fly   249 GSERCAANVAGVYTNVSYH--REWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 59/218 (27%)
Tryp_SPc 37..263 CDD:238113 61/220 (28%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 59/218 (27%)
Tryp_SPc 42..271 CDD:238113 59/218 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.