DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and AgaP_AGAP006674

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_316711.4 Gene:AgaP_AGAP006674 / 1277264 VectorBaseID:AGAP006674 Length:306 Species:Anopheles gambiae


Alignment Length:326 Identity:90/326 - (27%)
Similarity:136/326 - (41%) Gaps:110/326 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LIAGILVILEASRTE-------------------AAVPRQ--------PDSRIVNGREATEGQFP 49
            :|||:|.:...:..|                   ..:|.:        |.:|||||::||.||||
Mosquito     8 VIAGLLAVCSLASAEWIDIDWSQVKPIDEFDHYWQRLPAEMQYLRHARPSARIVNGQQATPGQFP 72

  Fly    50 YQLSLRRQ---TVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMRTSGGT-------- 103
            ||::|...   ...:|||:|:::|:.:|||||:.|            |:.....|||        
Mosquito    73 YQVALLSNFGTGTGLCGATIITNNFLLTAAHCVVG------------GNGQVAIGGTAILGAHDR 125

  Fly   104 --VQPVK--------AIYKHPAYDRADMNFDVALLRTADGALSLPL---GKVAPIRLPTVGEAIS 155
              |:|.:        .|:.||:|:.:.:..|:|.:|     |:.|.   .:|.||.||...:|.:
Mosquito   126 TVVEPTQQRIAFAQSGIFVHPSYNPSTIRNDIATVR-----LNTPATFNARVQPIDLPARSDART 185

  Fly   156 -ESMPAVVSGWGH------------MSTSNPVLSSV----LKSTTVLTVNQEKCHNDLRHHGGVT 203
             ..:....||:|.            |.|.||:||:.    ..||.|:.. |..|   |...||  
Mosquito   186 FAGVEGTASGFGRTSDASTATSPVVMFTRNPILSNAQCNSFWSTAVVQA-QNVC---LDATGG-- 244

  Fly   204 EAMFCAAARNTDACQGDSGGPISAQ----GTLIGIVSW--GVGCADPYYPGVYTRLAHPTIRRWI 262
                      ...|.||||||::.|    ...:||.|:  ..|||.. .|.|:.|::.  .|.||
Mosquito   245 ----------RSPCNGDSGGPLAVQDGGRSLEVGIASFVSAAGCASG-APSVWVRISF--FRDWI 296

  Fly   263 R 263
            :
Mosquito   297 Q 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 81/272 (30%)
Tryp_SPc 37..263 CDD:238113 81/272 (30%)
AgaP_AGAP006674XP_316711.4 Tryp_SPc 59..296 CDD:214473 81/272 (30%)
Tryp_SPc 60..299 CDD:238113 82/274 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.