DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and AgaP_AGAP005704

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_315712.4 Gene:AgaP_AGAP005704 / 1276373 VectorBaseID:AGAP005704 Length:305 Species:Anopheles gambiae


Alignment Length:243 Identity:60/243 - (24%)
Similarity:102/243 - (41%) Gaps:46/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGREATEGQFPYQLSL---RRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIM 97
            ||:||.....|..||..::   .....:.||..::|..:.:|||.|::|  .:....|:...:..
Mosquito    61 RILNGVTVARGDIPYAAAILISEEFATYFCGGVLVSELFVLTAASCVEG--DRDLSITVLLDAAQ 123

  Fly    98 RTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLGKVAPIRLPTVGEAISE--SMPA 160
            ..:.|....|..|..||    |..:.|:|||| .:.|:.|. ..:.|:.||...:....  :..|
Mosquito   124 INTAGEFIAVSEIIVHP----APSDNDIALLR-LNRAVRLN-DNIRPVTLPNRRQRTMTFVNQLA 182

  Fly   161 VVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHH------------GGVTEAMFCAAARN 213
            .:||||..:::         :...|.:|..:.   :|:|            ..:|:...|....:
Mosquito   183 SISGWGRTASN---------TNEALPLNNLRL---VRNHVMSNFNCGVSFPFTITDQHICITGDS 235

  Fly   214 TDACQGDSGGP------ISAQGTLIGIVSWG--VGCADPYYPGVYTRL 253
            ..||.||.|||      ::.:..|||:.|:.  :||. ...|.|:||:
Mosquito   236 GSACAGDEGGPLTTVDVVTGRTFLIGLYSFTSFLGCG-MGRPTVHTRI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 60/243 (25%)
Tryp_SPc 37..263 CDD:238113 59/242 (24%)
AgaP_AGAP005704XP_315712.4 Tryp_SPc 61..289 CDD:214473 60/243 (25%)
Tryp_SPc 62..292 CDD:238113 59/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.