DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Ctrl

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:269 Identity:91/269 - (33%)
Similarity:134/269 - (49%) Gaps:31/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILEASRTEAAVPR-----QPDSRIVNGREATEGQFPYQLSLRRQT-VHICGASILSS 69
            ||...:.::|..|.....||.     ..:.|||||..|..|.:|:|:||:..| .|.||.|:::.
  Rat     3 LLSLTLSLVLLGSSWGCGVPAITPALSYNQRIVNGENAVPGSWPWQVSLQDNTGFHFCGGSLIAP 67

  Fly    70 NWAITAAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYK---HPAYDRADMNFDVALLRTA 131
            ||.:|||||    :..|....:..|...|:|......|.:|.|   ||:::...||.|:.||:.|
  Rat    68 NWVVTAAHC----KVTPGRHFVILGEYDRSSNAEPIQVLSISKAITHPSWNPNTMNNDLTLLKLA 128

  Fly   132 DGALSLPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTT--VLTVNQEKCHN 194
            ..|..  ..:|:|:.|.:..||:...:..|.:|||.:|....|..:.|:...  ::||||  |  
  Rat   129 SPARY--TAQVSPVCLASSNEALPAGLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQ--C-- 187

  Fly   195 DLRHHGG--VTEAMFCAAARNTDACQGDSGGPISAQ----GTLIGIVSWGVGCADPYYPGVYTRL 253
              |.:.|  :|::|.||......:||||||||:..|    ..||||||||....:...|.:|||:
  Rat   188 --RQYWGSRITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTENCNVQAPAMYTRV 250

  Fly   254 AHPTIRRWI 262
            :  ....||
  Rat   251 S--KFNTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 83/237 (35%)
Tryp_SPc 37..263 CDD:238113 84/238 (35%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 83/237 (35%)
Tryp_SPc 34..260 CDD:238113 84/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.