DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS33 and MRPS33

Sequence 1:NP_524380.1 Gene:mRpS33 FlyBaseID:FBgn0038426 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_057155.1 Gene:MRPS33 HGNCID:16634 Length:106 Species:Homo sapiens

Alignment Length:101 Identity:61/102 (60%)
Similarity:76/102 (75%) Gaps:0/102 (0%)


  Fly    13 TQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPIHKRDYVINWYPRHVETHLLMKNLRDYG 77
            ::||.||:.||.|:||||.|.||.||||||::|||.|:.|:....:|||.|.....||:.||..|
Human     5 SEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLG 69

  Fly    78 LFRDEHQDFKEEMKRLRKLRGKAPPKKGEGKRASKK 113
            |:|||||||.:|.|||:|||||..|||||||||:|:
Human    70 LYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKR 105

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS33NP_524380.1 MRP-S33 15..104 CDD:285492 53/89 (60%)
MRPS33NP_057155.1 MRP-S33 6..91 CDD:311962 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214798738
eggNOG 1 0.900 E1_KOG4104
Hieranoid 1 1.000
Homologene 1 1.000 H7729
Inparanoid 1 1.050 126 1.000 Inparanoid score I4631
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1612570at2759
OrthoFinder 1 1.000 FOG0006095
OrthoInspector 1 1.000 T1073982
orthoMCL 1 0.900 OOG5_133440
Panther 1 1.100 LDO PTHR13362
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3779
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.