DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS33 and mrps33

Sequence 1:NP_524380.1 Gene:mRpS33 FlyBaseID:FBgn0038426 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001002306.1 Gene:mrps33 ZFINID:ZDB-GENE-040715-6 Length:106 Species:Danio rerio

Alignment Length:101 Identity:60/102 (59%)
Similarity:75/102 (74%) Gaps:0/102 (0%)


  Fly    13 TQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPIHKRDYVINWYPRHVETHLLMKNLRDYG 77
            :.||.||..||.||||:|:|.|:.:|:|||.:|.|.|:.:|..|.:|||.|...:.:.:.||..|
Zfish     5 SNYALRMARLSARIFGDVSRQTDARSLKVVELFKEPPLAQRKEVYDWYPPHKIYYSMTQRLRYMG 69

  Fly    78 LFRDEHQDFKEEMKRLRKLRGKAPPKKGEGKRASKK 113
            |||||||||||||:||||||||..|.|||||||:||
Zfish    70 LFRDEHQDFKEEMRRLRKLRGKGRPNKGEGKRATKK 105

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS33NP_524380.1 MRP-S33 15..104 CDD:285492 51/89 (57%)
mrps33NP_001002306.1 MRP-S33 7..96 CDD:285492 51/89 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214797510
eggNOG 1 0.900 E1_KOG4104
Hieranoid 1 1.000
Homologene 1 1.000 H7729
Inparanoid 1 1.050 123 1.000 Inparanoid score I4637
OMA 1 1.010
OrthoDB 1 1.010 D1612570at2759
OrthoFinder 1 1.000 FOG0006095
OrthoInspector 1 1.000 T1053270
orthoMCL 1 0.900 OOG5_133440
Panther 1 1.100 LDO PTHR13362
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3779
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.