DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS33 and Mrps33

Sequence 1:NP_524380.1 Gene:mRpS33 FlyBaseID:FBgn0038426 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001041328.1 Gene:Mrps33 RGDID:1309217 Length:105 Species:Rattus norvegicus

Alignment Length:101 Identity:62/102 (61%)
Similarity:77/102 (75%) Gaps:0/102 (0%)


  Fly    13 TQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPIHKRDYVINWYPRHVETHLLMKNLRDYG 77
            ::||.||:.||.||||||||.|:.||||||.:|||:|:.|:....:|||.|.....||..||..|
  Rat     4 SEYAVRMSRLSARIFGEVARPTDSKSMKVVNLFSEQPLAKKKETYDWYPNHNTYFALMGTLRFLG 68

  Fly    78 LFRDEHQDFKEEMKRLRKLRGKAPPKKGEGKRASKK 113
            |:||||||||:|.:||:|||||..|:|||||||:||
  Rat    69 LYRDEHQDFKDEQRRLKKLRGKGKPRKGEGKRATKK 104

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS33NP_524380.1 MRP-S33 15..104 CDD:285492 53/89 (60%)
Mrps33NP_001041328.1 MRP-S33 6..95 CDD:285492 53/89 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214798532
eggNOG 1 0.900 E1_KOG4104
Hieranoid 1 1.000
Homologene 1 1.000 H7729
Inparanoid 1 1.050 129 1.000 Inparanoid score I4496
OMA 1 1.010
OrthoDB 1 1.010 D1612570at2759
OrthoFinder 1 1.000 FOG0006095
OrthoInspector 1 1.000 T1087622
orthoMCL 1 0.900 OOG5_133440
Panther 1 1.100 LDO PTHR13362
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.