DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS33 and rsm27

DIOPT Version :10

Sequence 1:NP_524380.1 Gene:mRpS33 / 41991 FlyBaseID:FBgn0038426 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_596273.1 Gene:rsm27 / 2540477 PomBaseID:SPBC30D10.12C Length:93 Species:Schizosaccharomyces pombe


Alignment Length:88 Identity:23/88 - (26%)
Similarity:45/88 - (51%) Gaps:7/88 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MNYLSNRIFGEVARTTNEKSMKVVRMFSEEPIHKRDYVINWYPRHVETHLLMKNLRDYGLFRDEH 83
            :|.||::|||...::.|.::   .|.|..:.: |...:.::||..:....|...|.| ..|.|..
pombe    10 LNILSSKIFGTQYKSNNSRT---GRKFVVQEL-KGAKLKSYYPATINYRQLRTLLND-KTFPDSD 69

  Fly    84 QDFKEEMK--RLRKLRGKAPPKK 104
            ::.:.|::  |:|:.:|.:..||
pombe    70 EELRMEIRKGRIRQGKGASKSKK 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS33NP_524380.1 MRP-S33 15..104 CDD:462417 21/86 (24%)
rsm27NP_596273.1 MRP-S33 5..82 CDD:462417 19/76 (25%)

Return to query results.
Submit another query.