DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS33 and rsm27

Sequence 1:NP_524380.1 Gene:mRpS33 FlyBaseID:FBgn0038426 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_596273.1 Gene:rsm27 PomBaseID:SPBC30D10.12c Length:93 Species:Schizosaccharomyces pombe

Alignment Length:88 Identity:23/89 (26%)
Similarity:45/89 (51%) Gaps:7/89 (8%)


  Fly    19 MNYLSNRIFGEVARTTNEKSMKVVRMFSEEPIHKRDYVINWYPRHVETHLLMKNLRDYGLFRDEH 83
            :|.||::|||...::.|.::   .|.|..:.: |...:.::||..:....|...|.| ..|.|..
pombe    10 LNILSSKIFGTQYKSNNSRT---GRKFVVQEL-KGAKLKSYYPATINYRQLRTLLND-KTFPDSD 69

  Fly    84 QDFKEEMK--RLRKLRGKAPPKK 104
            ::.:.|::  |:|:.:|.:..||
pombe    70 EELRMEIRKGRIRQGKGASKSKK 92

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS33NP_524380.1 MRP-S33 15..104 CDD:285492 22/87 (25%)
rsm27NP_596273.1 MRP-S33 7..83 CDD:285492 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.