DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS33 and mrps-33

Sequence 1:NP_524380.1 Gene:mRpS33 FlyBaseID:FBgn0038426 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_501505.1 Gene:mrps-33 WormBaseID:WBGene00009013 Length:126 Species:Caenorhabditis elegans

Alignment Length:100 Identity:43/100 (43%)
Similarity:62/100 (62%) Gaps:2/100 (2%)


  Fly    13 TQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPIHKRDYVI-NWYPRHVETHLLMKNLRDY 76
            |.:.:||:.||||::|||...|:.||:||||:.|.||...::.:. .:||.....|.|.|.||.:
 Worm    21 TPFGKRMDRLSNRVWGEVVMPTDTKSLKVVRVMSAEPYETKEQLSPKYYPNLPMFHYLTKMLRFH 85

  Fly    77 GLFRDEHQDFKEEMKRLRKLRGK-APPKKGEGKRA 110
            |||.|:|..|::....|:.:||| ..|..|:||||
 Worm    86 GLFFDDHVVFRDVQDNLKIIRGKVVRPPIGQGKRA 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS33NP_524380.1 MRP-S33 15..104 CDD:285492 37/91 (41%)
mrps-33NP_501505.1 MRP-S33 25..109 CDD:285492 36/84 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214220051
eggNOG 1 0.900 E1_KOG4104
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I3792
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1612570at2759
OrthoFinder 1 1.000 FOG0006095
OrthoInspector 1 1.000 T476829
orthoMCL 1 0.900 OOG5_133440
Panther 1 1.100 LDO PTHR13362
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3779
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.