DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS33 and mrps33

Sequence 1:NP_524380.1 Gene:mRpS33 FlyBaseID:FBgn0038426 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_017945824.1 Gene:mrps33 XenbaseID:XB-GENE-970493 Length:111 Species:Xenopus tropicalis

Alignment Length:101 Identity:68/102 (67%)
Similarity:80/102 (78%) Gaps:0/102 (0%)


  Fly    13 TQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPIHKRDYVINWYPRHVETHLLMKNLRDYG 77
            :.||.||:.||.||||||.|.|:::|||||:||||||:.||..|.:|||.|.....||:|||..|
 Frog    10 SSYALRMSRLSARIFGEVVRPTDQRSMKVVKMFSEEPLAKRKEVFDWYPPHNTYVSLMRNLRYLG 74

  Fly    78 LFRDEHQDFKEEMKRLRKLRGKAPPKKGEGKRASKK 113
            |:||||:||||||:||||||||..|||||||||.||
 Frog    75 LYRDEHEDFKEEMRRLRKLRGKGTPKKGEGKRAMKK 110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS33NP_524380.1 MRP-S33 15..104 CDD:285492 59/89 (66%)
mrps33XP_017945824.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214805569
eggNOG 1 0.900 E1_KOG4104
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7729
Inparanoid 1 1.050 138 1.000 Inparanoid score I4296
OMA 1 1.010
OrthoDB 1 1.010 D1612570at2759
OrthoFinder 1 1.000 FOG0006095
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3779
TreeFam 1 0.960
109.800

Return to query results.
Submit another query.