DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14880 and CG14301

Sequence 1:NP_650538.1 Gene:CG14880 FlyBaseID:FBgn0038422 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_650734.2 Gene:CG14301 FlyBaseID:FBgn0038632 Length:196 Species:Drosophila melanogaster

Alignment Length:92 Identity:36/93 (39%)
Similarity:50/93 (54%) Gaps:11/93 (12%)


  Fly    32 NAIPKTNPASLLIQKTSFSCAGRP-AGYYADVETGCQVYHMCDGLGRQFSYTCPNTTLFQQRMLI 95
            :|:|.||          |.|..:. .|::||:||.||.:|.||..|||.::.|||.|.|.|.:.:
  Fly    95 SAVPYTN----------FYCDEQEYPGFFADMETRCQGWHYCDIDGRQATFLCPNGTQFSQAVFV 149

  Fly    96 CDHWYMVNCSKAESNYAANLLIGQRDK 122
            ||.|:.|.|..:...||.|..:.||.|
  Fly   150 CDWWFNVRCDLSPRLYAINARLYQRPK 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14880NP_650538.1 CBM_14 51..104 CDD:279884 24/54 (44%)
COG3979 336..>457 CDD:226487
CG14301NP_650734.2 CBM_14 104..156 CDD:279884 23/52 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AA9A
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.