DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14880 and thw

Sequence 1:NP_650538.1 Gene:CG14880 FlyBaseID:FBgn0038422 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001097699.2 Gene:thw FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster

Alignment Length:744 Identity:174/745 (23%)
Similarity:265/745 (36%) Gaps:224/745 (30%)


  Fly    44 IQKTSFSCAGRPAGYYADVETGCQVYHMCDGLGRQFSYTCPNTTLFQQRMLICDHWYMVNCSKAE 108
            |.||||||.....||:||:||.|||:|:|:. ||:.|:.|||.|:|||..|.||.|:.|||..:.
  Fly   105 IPKTSFSCRSYGNGYFADMETDCQVFHICEE-GRKISFLCPNGTIFQQSELTCDWWFKVNCLGSS 168

  Fly   109 SNYA--ANLLIGQR---------------------DKPFVNDEENSLRT--PR--PD-----LLD 141
            ..||  |.:|..||                     .||.|.......|:  ||  ||     ..|
  Fly   169 GYYAESAEILNKQRVHRVRPSVPVQGFNIVGGGLNIKPKVTPVAGQGRSAAPRANPDRRIDSTED 233

  Fly   142 RPYA------PDYSGESFRSQYKQFTSNQN----QIRDES---VKGAGAGKSDPQISQTRWRIPP 193
            .|.:      .|.|||..|.......:|.|    ||..||   |.|:|..:::.:.:        
  Fly   234 VPASVESVDFDDVSGEKQRKVLPSIDNNSNDQESQITAESSSFVSGSGKRRTNKESN-------- 290

  Fly   194 PSR----TILPPAYEPQIELPSAQSAKPRIPIITST--TTTTRATTTTRPTTTTRATTTTTTTRR 252
            |:|    |:|.|             |:.|.|:.|..  .:|.||....|.......:...:..|.
  Fly   291 PNRNDDITVLKP-------------ARLRTPVATQERGVSTERARNGQRGQHRYSGSEEHSKERE 342

  Fly   253 PPVTARPKEALHNRRPNFQEHDMDDLGTSHSTRY--NTSADFNS-AESPLRETKQSSTKLTKFIK 314
            .|...:.||     :|.|.|        :||||.  .|:|.::: :.|.:|..:.|  |.|.|..
  Fly   343 RPTPGQSKE-----KPEFFE--------AHSTRSVPQTTAHYSTGSHSTVRRLEPS--KSTPFYT 392

  Fly   315 P------PSKIYEPPFVYPIYNLEESQTQNAAVATTLRTSTAAPFSPVPSRKEVST------TTP 367
            |      .||..|....|         .:...||||          |.|.|...::      ::.
  Fly   393 PTVPSLVKSKSTEGKLNY---------IKGGHVATT----------PNPHRFGSASSGIFIESSV 438

  Fly   368 RPLSRPTTLAGVPFSSATHPTTVTT---VGVPPRSDNRTPAPAQSFR--LATPTSTAAPPSRPAQ 427
            .|..:||..|.:...|...|..:..   ..|....:.|.|:.:...|  |.|..|.:|..|.|..
  Fly   439 APKVKPTASASIELDSTFKPVIIGMRHHYDVASSGEFRPPSKSTESRDYLPTTPSPSAASSGPTY 503

  Fly   428 LPFNDLLP----------PFVDFVPH------------DIATTQG--PPIYYEWKVPSNGLEPPK 468
            ||.:...|          ..:.|.|:            |:..|..  ...:.:.::.:....|.:
  Fly   504 LPMSGKSPRVNTGGAAGEDVLLFAPNPVKEESVFRNVQDMLKTMNLLKDQFEDVELNAAAAAPAR 568

  Fly   469 LDPPIGVDGREYPETTGDYGVTSKQDVF----NTRLNDIGSHQKKPVQITSPLQQSSTSHRLAIS 529
            :       |.|.|.::|...:.|....|    |..:|.:....|     :..:.::....:|::.
  Fly   569 V-------GLEIPPSSGPDALVSFAKYFAQEHNETINSLSKKDK-----SEKVDKTGVQTKLSVK 621

  Fly   530 ---RSIKPKEEQESAQRRSDVVASSTDISHLRKQFL----IPEYA--FPLETIGRTGYGPGAGAA 585
               .:|||.:.........:..|.|.:...::|..|    :.:|:  |.|    ::..|.|||.:
  Fly   622 PPLPTIKPSDTTALLTTSENPPAISDNADDIKKSLLSDTTVKKYSNLFGL----KSAQGRGAGES 682

  Fly   586 ----------AGGSGSSNGDLYNSFQ------------LKIPEQR--AKWFG-------ENPKC- 618
                      ..|:.|..|..|..:.            .:.||.|  |:.|.       :||.. 
  Fly   683 DISSGLLSNQTNGTQSEAGSKYQQYPQIGSTGSTIGALAEKPETRKIAQIFSNALSSYLDNPATF 747

  Fly   619 ------------PECHPSFVLPGTCEPCL 635
                        |...|:|....|.:|.|
  Fly   748 RAELAARARPTEPPSTPNFKPVTTTDPSL 776

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14880NP_650538.1 CBM_14 51..104 CDD:279884 28/53 (53%)
COG3979 336..>457 CDD:226487 30/156 (19%)
thwNP_001097699.2 CBM_14 112..164 CDD:279884 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.