DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14880 and CG13676

Sequence 1:NP_650538.1 Gene:CG14880 FlyBaseID:FBgn0038422 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_648179.3 Gene:CG13676 FlyBaseID:FBgn0035844 Length:883 Species:Drosophila melanogaster

Alignment Length:791 Identity:161/792 (20%)
Similarity:234/792 (30%) Gaps:302/792 (38%)


  Fly    49 FSCAGRPAGYYADVETGCQVYHMCDGLGRQFSYTCPNTTLFQQRMLICDHWYMVNCSKAESNYAA 113
            |.|.|...|:||.:|..||:||.| ..|.:..:.|.|.|.|.||..||.....|:|..::..:..
  Fly   128 FKCEGLHDGFYASIEYKCQIYHHC-VYGIRHDFLCANFTAFDQRTFICHFASDVDCEGSQKYWNR 191

  Fly   114 NLLIGQRDKPFV---NDEENSLRTPRPDLLD-----RPYAPDYSGESFRSQYKQ------FTSNQ 164
            |      |:.::   ....::..||.|..|.     ||..|.   ...|..|.:      :..:|
  Fly   192 N------DELYMATTTTSTSTTTTPAPPTLPPAPRRRPQRPQ---RPLRRPYNRRPIDDYYYEDQ 247

  Fly   165 NQIRDESVKGAGAGKSDPQISQTRWRIPPPSRTILPPAYEPQIELPSAQSAKPRIPIITSTTTTT 229
            :|..|:..:.....:..|:        |...:..:.|.|:.:.:....::.||    |.......
  Fly   248 DQYEDDYYEERPVRRPKPR--------PRQRKPQVEPEYDDEYDDKRTEAKKP----IRRNRNRY 300

  Fly   230 RATTTT-------RPTTTTRATTTTTT-----TRRPPVTARPKEALHNRRPNFQEHD-------- 274
            |.....       ||:...|...|..|     :.|.|.....:.:.:..||..:...        
  Fly   301 RDEEEALDEDYDERPSKRPRGKPTAGTAGRKISPRKPGRVEERRSFNEDRPLGRRRSEKERTTPS 365

  Fly   275 --MDDLGTSHSTRYNTSADFNSAESPL-RETKQSSTKLTKFIKP-------------PSKIYEP- 322
              :||| ..:...||::....:||... ::.|.:...||:||.|             |.:|..| 
  Fly   366 SALDDL-DEYEKPYNSADQVEAAEEQTPQKVKTTPKPLTEFITPKAAAASVYARPRAPPRIARPV 429

  Fly   323 ------PFVYPIYNLEESQTQNAAVATTLRTSTAAPFSPVPSRKEVSTTTPRPLSRPTTLAGVPF 381
                  .|.||:..:         .|||...|.:|........::|.....:|.:|.|.....|.
  Fly   430 PINEKKKFSYPVQKI---------TATTQAPSNSAQEEEDYPEEQVEEDYEQPPARNTPRRRTPA 485

  Fly   382 SSATHPTTVTTVGVP----------------------------PRSDNRTPAPAQSF------RL 412
            |.|....|.||:..|                            |||  |.||....|      ..
  Fly   486 SRAEQKPTRTTLRKPVTDKKPVDEEYDEPAEPEPLRKRKRPLAPRS--RVPAADVDFEDEEYEES 548

  Fly   413 ATPTSTAAP-----------------PSRP----------------------------------- 425
            ..|.|||||                 |.||                                   
  Fly   549 PAPVSTAAPLRNQRLRAKTTTRKPTAPPRPRKPIVEDEEELEHPVEAVEDEAPAPRSRANSLSGR 613

  Fly   426 ---------------AQLPF------NDLLP-------------PFVDFVPHDIATT-------- 448
                           .:.||      :..||             |..|..|.|:.:|        
  Fly   614 NAGAGFSQRPSSVRVVKRPFLPSRGGSPYLPRGLQPVGVALKPLPTTDSTPIDMGSTISGVRLLE 678

  Fly   449 QGPPIYYEWKVPSNGLE-----PPKLDPP----------IGVDGREYPET---------TGDYGV 489
            .|.|:..  ..|.:|.:     ||...||          .....|..|:.         ..||.|
  Fly   679 HGAPLLR--GNPDSGEDDEEDAPPSPSPPRTTLPPRSALPATPKRVEPQRPKLNLDELYENDYDV 741

  Fly   490 TSKQDVFNTRLNDIGSHQKKPVQITSPLQQSSTSHRLAISRSIKPKEEQ---------------- 538
            |         |||......||:   ||......||:|...:..:..:.|                
  Fly   742 T---------LNDALDPTLKPL---SPQHPHPHSHQLPYQQQQQQSQRQYASAYNPFAYQPAYQS 794

  Fly   539 -------------ESAQRRSDVVASSTDISHLRKQFLIP---------EYAFPLETIGRTGYGPG 581
                         ::|...||...|||||   |::.::|         |||    ..|....||.
  Fly   795 PTSASASAPASASQAASYHSDSYFSSTDI---RRRAIVPAQTARPHRLEYA----AAGGAAGGPS 852

  Fly   582 AGAAAGGSGSS 592
            :|.|..|||.|
  Fly   853 SGGAVSGSGVS 863

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14880NP_650538.1 CBM_14 51..104 CDD:279884 21/53 (40%)
COG3979 336..>457 CDD:226487 43/249 (17%)
CG13676NP_648179.3 CBM_14 130..182 CDD:279884 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.