DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17929 and CG33282

Sequence 1:NP_650532.2 Gene:CG17929 FlyBaseID:FBgn0038415 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:475 Identity:105/476 (22%)
Similarity:177/476 (37%) Gaps:110/476 (23%)


  Fly    69 FAH--SAGWNQTLNTTATQV-------------FKCSWFIGVLAG--AALASLTMTFL-----PK 111
            |.|  ..||   |:.|.|::             .:.|| :|.:.|  :...:||:..|     .|
  Fly    29 FGHGVGVGW---LSPTLTKIQTADSPLDFEVNLAQISW-LGSMLGLDSLCGNLTIAMLIERAGRK 89

  Fly   112 LPFYVLGGLMQLTGSIIFTCKPFDYGCLLAARYVAG--AGIGLITVPFLIHSAEVATDNHRGVSG 174
            ...|::.|.......:|:......|  |.|||::.|  .|.|.:.||..|  :|||..|.||...
  Fly    90 FCLYLMAGPYACIWILIYCASNVYY--LYAARFLCGFTGGAGYLVVPIFI--SEVADSNIRGALT 150

  Fly   175 SMEQCGLALGIAIQVIYDTQWVDDKEASVNEVHGIIGIVFSIIGLGMTALSIESPIYYLRIKQKE 239
            ||....:.|||....|..|.       ....|...:.|:..:.......:..|:..|.|:..|..
  Fly   151 SMVMLSVDLGILAGYILSTY-------LAYHVVPFLAIILPVAYFIANIMLPETAPYLLKKSQLA 208

  Fly   240 KARKCHAKLLGSFNHSVDQ-----------EFEEIQLYVAESQKR--TFCQELRISVVPFIKLLL 291
            .|.       .||.:..:|           .|||::..|...|.|  |......::..|.:|   
  Fly   209 AAE-------NSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLSYKDLTTKPALK--- 263

  Fly   292 YRGFVA-------------FSFSLPLSESLIKSALLTEGFISCWPVTVWGLVRLLGALVAQGFLD 343
              ||.|             |||...:|:....|..:.:  ::...:.: |||:::|...:...:|
  Fly   264 --GFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVD--VNTATIII-GLVQIVGVYTSTILVD 323

  Fly   344 KLGRKFVSL-----VGLLCMAILMLCMAASYANPAN------ALMTYYMYQVWRLGLAFQAFAGL 397
            .:||:.:.|     ||:.|:|.......|...:.::      .||....| |..:||     .|:
  Fly   324 IVGRRVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLVLMIIICY-VANIGL-----IGI 382

  Fly   398 FVCSSSVYLGEAFPIKVKPFFVGYIIGFEQTIHIINIVGYNKGYENFFYHYYLSV-----GIILL 457
            |.    :.|.|.||:|::.......:.|...:    :.|..|.:....:::.:|.     ....|
  Fly   383 FF----LVLVELFPVKIRSLATSLSVIFLSLL----VFGTLKLFPLMLHYWGISFTMWFSAASAL 439

  Fly   458 VGVVFFGIVIPETKKTTLRE 477
            :...:|.:.:.|||..::.|
  Fly   440 LTFFYFWLFLQETKGKSMIE 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17929NP_650532.2 Sugar_tr 67..482 CDD:278511 105/476 (22%)
MFS 295..>425 CDD:119392 33/154 (21%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 101/463 (22%)
MFS_1 53..409 CDD:284993 89/393 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97412528
eggNOG 1 0.900 E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.