DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mat89Ba and UTP22

Sequence 1:NP_650530.2 Gene:Mat89Ba FlyBaseID:FBgn0261286 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_011604.3 Gene:UTP22 SGDID:S000003322 Length:1237 Species:Saccharomyces cerevisiae

Alignment Length:1302 Identity:308/1303 (24%)
Similarity:530/1303 (41%) Gaps:263/1303 (20%)


  Fly    20 AARTGTQAIAHA-GDHSDLDEPKPKIAK-SDPPSTAIPKKNNFKQREGTKNVKPPTLE------- 75
            |:.|..|.|... ..||..|......:| :|..|.||.::...:|.....:..|.:.|       
Yeast     9 ASETSDQNIVKVQKKHSTQDSTTDNGSKENDHSSQAINERTVPEQENDESDTSPESNEVATNTAA 73

  Fly    76 -------------EMKELRDTQNLFHSNLFKLQVKEMLEELQLKQKYTDFIENWLESFTAFTRQL 127
                         ::...|:|..||.||:||||:.|:||:::||||:...:|.:|.......:::
Yeast    74 TRHNGKVTATESYDIHIARETAELFKSNIFKLQIDELLEQVKLKQKHVLKVEKFLHKLYDILQEI 138

  Fly   128 K----------DGLMERTHLEVPMKLSEKP----TGFVFSKPTREPYLIGAAA--TGTLLGPKIV 176
            .          |...:...:.||. :..||    |.:.|:....:..|||:.|  .|........
Yeast   139 PDWEEKSLAEVDSFFKNKIVSVPF-VDPKPIPQNTNYKFNYKKPDISLIGSFALKAGIYQPNGSS 202

  Fly   177 VDVALEMPKESLHKEDYLNLRYDQKRALYLTYVTERM--MESPDYAED--QFNFNYYANNPLKPV 237
            :|..|.||||...|:|:||.|...||::||.|:|..:  :...|..:.  |..::|:.|:||.|:
Yeast   203 IDTLLTMPKELFEKKDFLNFRCLHKRSVYLAYLTHHLLILLKKDKLDSFLQLEYSYFDNDPLLPI 267

  Fly   238 LELIPVTKQVNKHL----------QVRLFITAPLSSFKPGRFVPWNNNIRPSFYGDEWDEKDPLP 292
            |. |..:|.....|          .:.|.|..|...|:|.:.:|..|.||.:    :..::..||
Yeast   268 LR-ISCSKPTGDSLSDYNFYKTRFSINLLIGFPYKVFEPKKLLPNRNCIRIA----QESKEQSLP 327

  Fly   293 STQHYNANVLFDLTLSENQAQLDKAFKSRRNFQDGLLLLKVWLRQRQLDIGYS----------GF 347
            :|..||.:||...|.......|.|..|...:|.:..:|.::||:||    |:|          ||
Yeast   328 ATPLYNFSVLSSSTHENYLKYLYKTKKQTESFVEATVLGRLWLQQR----GFSSNMSHSGSLGGF 388

  Fly   348 GAH---ILAAFIVY---LNTQRILHQSSSSYQVARTVWNQLANTDWTKGISLSV-APIQTEELNK 405
            |..   ||.|.::.   :|:.:||....||||:.:.|...||..|......|.. :..:....:.
Yeast   389 GTFEFTILMAALLNGGGINSNKILLHGFSSYQLFKGVIKYLATMDLCHDGHLQFHSNPENSSSSP 453

  Fly   406 FAEHYDVCF-----IDFTGQHNLCANIPLYLYQRVREEAKLAVELLNDMKLNSFPLIFMQKCPLY 465
            .:::.|..|     .|.:.:.|:...:.:..||.::|.|...:.:||::..:.|..||:..   .
Yeast   454 ASKYIDEGFQTPTLFDKSTKVNILTKMTVSSYQILKEYAGETLRMLNNVVQDQFSNIFLTN---I 515

  Fly   466 SRVDNI---------LKISNYSCINQML--TLHSHPRIKY-DFANYGYPQLLHLLTELLKKGLAE 518
            ||.||:         |.:..|:.:...|  |..|..|:|: ...|:    |.|.:|.:.:..|.:
Yeast   516 SRFDNLKYDLCYDVQLPLGKYNNLETSLAATFGSMERVKFITLENF----LAHKITNVARYALGD 576

  Fly   519 RVHSI-LPLETATAAWPVEKKAPVIG--------KYIQLGLILQPEHAYQVLNKGPAANDD-HEG 573
            |:..| :.:....:.:|:.|:.....        .::::.||:.|....:::.||||.::. ...
Yeast   577 RIKYIQIEMVGQKSDFPITKRKVYSNTGGNHFNFDFVRVKLIVNPSECDKLVTKGPAHSETMSTE 641

  Fly   574 AEEFRRFWGEKSNLRRFQDGSITEAVVWGTAQDSPAKKRLIVRQIVLHLLEHHLQLDSKEVQYIG 638
            |..|:.|||.||:||||:|||||...||.|:...|     |:..||...|:.|:   ||:.|...
Yeast   642 AAVFKNFWGIKSSLRRFKDGSITHCCVWSTSSSEP-----IISSIVNFALQKHV---SKKAQISN 698

  Fly   639 GELDQVYQLSPWFKVNKLKTKLPLGQDTDAEALSP--HVIRCYDELARQLHGLNDLPLEIVSISG 701
            ..:.:.:...|       ...||....|....||.  ::.:.:|:|.:.:..:. |||.:.||..
Yeast   699 ETIKKFHNFLP-------LPNLPSSAKTSVLNLSSFFNLKKSFDDLYKIIFQMK-LPLSVKSILP 755

  Fly   702 VSPIFRY---CEPQPVLPQALLVENRILASS----IQRVVIQLGQSGKWPTELGALRALKTAFLI 759
            |...|||   |:|.|            .|.|    .|.|:::...|.|||.|:.:|...|||||:
Yeast   756 VGSAFRYTSLCQPVP------------FAYSDPDFFQDVILEFETSPKWPDEITSLEKAKTAFLL 808

  Fly   760 EIGEKLEAQCRLH-WVMSADGL-----------LVLKQGYCFLI-------ELAHNKELALLKQE 805
            :|.|:|.|....: ...|.|..           ::..:||.|..       |:.:.:.:|..:.|
Yeast   809 KIQEELSANSSTYRSFFSRDESIPYNLEIVTLNILTPEGYGFKFRVLTERDEILYLRAIANARNE 873

  Fly   806 VTERGITTYIDNAASRSLERQHYILPKVSGALHSLHQTYSAFGSTVLLAKRWLATQLLDDGLWPD 870
            :......|::...|......:|      :..|.::..:|..:...|.|.||||.|.||...:..:
Yeast   874 LKPELEATFLKFTAKYLASVRH------TRTLENISHSYQFYSPVVRLFKRWLDTHLLLGHITDE 932

  Fly   871 MATELLVAHLF---QQRYAPQSIAAPQTGFIRFLQLLSHSDFNGELFLLNFNNSWQEQQIAD--- 929
            :| ||:....|   ...:.|.|:   :.||::.|:.:|..::..:..:|:...  .|..|.|   
Yeast   933 LA-ELIAIKPFVDPAPYFIPGSL---ENGFLKVLKFISQWNWKDDPLILDLVK--PEDDIRDTFE 991

  Fly   930 ----------------------------LEHNYRSNRQSYP-----PLAVATSYDMQHAGRLWTS 961
                                        ::.|:.:.|.|.|     ...||:..|  .:|.|::|
Yeast   992 TSIGAGSELDSKTMKKLSERLTLAQYKGIQMNFTNLRNSDPNGTHLQFFVASKND--PSGILYSS 1054

  Fly   962 D-QSPSQRVLGHVTRLARHALEIIET-SLMSKDLRFVRPAQLFRASNEGYDLVIQFKPDLVPNSL 1024
            . ..|   :...:|.||:.|:.:::| .|..:.:..     ||....:.||.|:..:   .|..|
Yeast  1055 GIPLP---IATRLTALAKVAVNLLQTHGLNQQTINL-----LFTPGLKDYDFVVDLR---TPIGL 1108

  Fly  1025 SYDLGSPFVSFSQ-PNFSLPRAGSDY-------------IARIVGLLRSAYSDFAAF----FYNP 1071
            ....|  .:|.:: .|.:..:|.|::             ..::|..|...|.:....    :...
Yeast  1109 KSSCG--ILSATEFKNITNDQAPSNFPENLNDLSEKMDPTYQLVKYLNLKYKNSLILSSRKYIGV 1171

  Fly  1072 HGGKE------LGIVWRPPTEFAAKPFKVTELQACSPCGNKKVQVLKETLLEDFKLLLKDFYLRI 1130
            :||::      .|::  .|....|..|:|.......|..::.|.:.||.:..:......|..:..
Yeast  1172 NGGEKGDKNVITGLI--KPLFKGAHKFRVNLDCNVKPVDDENVILNKEAIFHEIAAFGNDMVINF 1234

  Fly  1131 AT 1132
            .|
Yeast  1235 ET 1236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mat89BaNP_650530.2 Nrap 166..1130 CDD:281764 263/1117 (24%)
UTP22NP_011604.3 Nrap 188..1236 CDD:281764 263/1121 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C324295869
eggNOG 1 0.900 E1_KOG2054
Hieranoid 1 1.000
Homologene 1 1.000 H41505
Inparanoid 1 1.050 223 1.000 Inparanoid score I755
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003906
OrthoInspector 1 1.000 T1135975
orthoMCL 1 0.900 OOG5_128598
Panther 1 1.100 LDO PTHR17972
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1619
TreeFam 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.