DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mat89Ba and AT1G63810

Sequence 1:NP_650530.2 Gene:Mat89Ba FlyBaseID:FBgn0261286 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001320199.1 Gene:AT1G63810 AraportID:AT1G63810 Length:1053 Species:Arabidopsis thaliana

Alignment Length:1113 Identity:288/1114 (26%)
Similarity:513/1114 (46%) Gaps:156/1114 (14%)


  Fly    94 LQVKEMLEELQLKQKYTDFIENWLESFTAFTRQLKDGLMERTHLEVPMKL---------SEKPTG 149
            |:|.::|::.:|..   |.:...::...:..::..||:.|:  .:|..:|         ::|...
plant    12 LKVNDLLKDARLDY---DSLRKLVDDTVSSIKEAIDGIPEK--FQVTSELAPSFVEDIGADKEVE 71

  Fly   150 FVFSKPTREPYLIGAAATGTLLGPKIVVDVALEMPKESLHKEDYLNLRYDQKRALYLTYVTERMM 214
            |.|.||... .|.|:.:...:..|...||:.:.:|||..:::||:|.||..||.|||..:.:.::
plant    72 FSFKKPNGF-NLCGSYSICGMAKPDTSVDLLVHLPKECFYEKDYMNHRYHAKRCLYLCVIEKHLL 135

  Fly   215 ESPDYAEDQFNFNYYANNPLKPVLELIPVTKQVNKH--LQVRLFITAPLSSFKPGRFVPWNNNIR 277
            .|...  ::..::...|...||||.:.| .|::::.  ..:|| |.:..|.|...:.....||:|
plant   136 SSSSI--EKVVWSTLHNEARKPVLVVFP-AKKLDQFPGFSIRL-IPSATSLFSVAKLSISRNNVR 196

  Fly   278 PSFYGDEWDEKDPLPSTQHYNANVLFDLTLSENQAQLDKAFKSRRNFQDGLLLLKVWLRQRQLDI 342
             |...|...|  |.|:   ||:::|.|:.|.||...|.|.|...:...|.|:|||:|.|||....
plant   197 -SVTADGVPE--PTPT---YNSSILEDMFLEENSEFLKKTFSEWKELSDALILLKIWARQRSSIY 255

  Fly   343 GYSGFGAHILAAFIVYLNTQRILHQSSSSYQVARTVWNQLANTD-WTKGISL---SVAPIQTEEL 403
            .:......:::..:.||.|...::::.|:..:.|...:.:|.:. |.:|:.|   |...:..||.
plant   256 VHDCLNGFLISVILSYLATHSKINKALSALDIFRVTLDFIATSKLWERGLYLPPQSEIRVSKEEK 320

  Fly   404 NKFAEHYDVCFIDFTGQHNLCANIPLYLYQRVREEAKLAVELLNDMKLNSFPLIFMQKCPLYSRV 468
            .:|.|.:.|...|.:...||...:....:..:::||.|.::.:..::...|..|||.|.....:.
plant   321 MQFRELFPVVICDSSTFVNLAFRMTSVGFLELQDEASLTLKCMEKLRDGGFEEIFMTKIDYPVKY 385

  Fly   469 DNILK----------ISNYSCINQMLTLHSHPRIKYDFANYGYPQLLHLLTELLKKGLAERVHSI 523
            |:.::          :|.:....:...|              |.|.:|   .||.:||.:|..||
plant   386 DHCIRLQLKGKTAVSLSGFCLDKECWRL--------------YEQKVH---SLLLEGLGDRAKSI 433

  Fly   524 -LPLETATAAWPVEKKAPVIGKY-IQLGL-ILQPEHAYQVLNKGPAANDDHEGAEEFRRFWGEKS 585
             :........|.||....|:.:. :.:|: :...|.||:.::.||.|.:..| |..||:||||||
plant   434 RVVWRNTNQDWHVESGLSVLDREPLFIGISVSSTEKAYRTVDIGPDAENKIE-ALRFRKFWGEKS 497

  Fly   586 NLRRFQDGSITEAVVWGTAQDSPAKKRLIVRQIVLHLLEHHLQLDSKEVQYIGGELDQVYQLSPW 650
            :||||:||.|:|:.||.|.|.:   |.||::|||.::|:.||.|.|          |.:.||   
plant   498 DLRRFKDGRISESTVWETQQWT---KHLIMKQIVEYILKRHLSLTS----------DDIVQL--- 546

  Fly   651 FKVNKLKTKLPLGQDTDAEALSPHVIRCYDELARQLHGLNDLPLEIVSISGVSPIFRYC-----E 710
              |::|...|..| ..|..:||.::::.|:.|::.|..:..:||::.|:..:....|:.     |
plant   547 --VDQLDFSLNYG-GKDPISLSGNLVQAYEVLSKCLREIEGIPLKVSSVQSLDSALRFTSVFPPE 608

  Fly   711 PQPVLPQALLVENRILASSI------QRVVIQLGQSGKWPTELGALRALKTAFLIEIGEKLEAQC 769
            |.||..:.  :::|.|...|      ..|:|||..||.||.:..|:...|:|||::|.|.|:...
plant   609 PHPVACEK--IDSRRLQKLIPSCIPAMEVMIQLEGSGNWPMDDLAVEKTKSAFLLKIAESLQNVK 671

  Fly   770 RLHWVMSADGLLVLKQGYCFLIELAHNKELALLKQEVTERGITTYIDNAASRSLERQHYILPKVS 834
            .:....:.|.:.|...||.|.:.:.|.:.|:|:|:|:   |:.. :.:.:  |.::..:|..:.:
plant   672 GIPCTATEDNVDVFIGGYAFRLRILHERGLSLVKREI---GVDP-VKHVS--STDKMLFIRSQHA 730

  Fly   835 GALHSLHQTYSAFGSTVLLAKRWLATQLLDDGLWPDMATELLVAHLFQQRYAPQSIAAPQT---G 896
            ..::.|...:..:.....|||||::..|. .|...:.|.|||||:||   ..|..:..|.:   |
plant   731 SMINGLQGRFPVYAPVARLAKRWVSAHLF-SGCLAEEAIELLVAYLF---LTPLPLGVPSSRING 791

  Fly   897 FIRFLQLLSHSDFNGELFLLNFNNSWQEQQIADLEHNYRSNRQSY--------PPLAVATSYDMQ 953
            |:|||:||:..::.....:::.||.:......::..|:.|:|:.|        ..:.:|..||  
plant   792 FLRFLRLLADYEWMFYPLIVDINNDFGRNDEKEINDNFMSSRKGYEEDKQNISSAMFLAAPYD-- 854

  Fly   954 HAGRLWTSDQSPSQRVLGHVTRLARHALEIIETSLMSKDLRFVRPAQLFRASNEGYDLVIQFKPD 1018
            .|...||| .||:......:...||.:..::...::.:....|:...|||.....||.||....|
plant   855 KASEAWTS-TSPNLLEQKRLVAYARSSANVLSKMVLQEHNDSVQWECLFRTPLNNYDAVILLHRD 918

  Fly  1019 --------LVPNSLSYD----------LGSPFVSFSQPNFSLPRAGSDYIARIV-------GLLR 1058
                    |.|:.|:..          |.:||:|   |. .|.|:..:...:::       .||.
plant   919 KLPYPRRLLFPSELNQGKHVARGKASRLFNPFMS---PG-DLKRSHEELKNKLMVDFEPTKCLLS 979

  Fly  1059 SAYSDFAAF--FYNPHGGKELGIVW-RPPTEFAAKPFKVTELQACSPCGNKKVQVLKETLLEDFK 1120
            ....:|...  :|:..||..:|:.| :..::...:..:..|.:..:|     :::|| .:.|..|
plant   980 GLQEEFGTLKPWYDHIGGDAIGLTWNKHNSKKRERDEEEEEEEESNP-----MEMLK-AVGEMGK 1038

  Fly  1121 LLLKDFYL 1128
            .|::|.||
plant  1039 GLVRDIYL 1046

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mat89BaNP_650530.2 Nrap 166..1130 CDD:281764 271/1033 (26%)
AT1G63810NP_001320199.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H41505
Inparanoid 1 1.050 285 1.000 Inparanoid score I837
OMA 1 1.010
OrthoDB 1 1.010 D176625at2759
OrthoInspector 1 1.000 T193257
orthoMCL 1 0.900 OOG5_128598
Panther 1 1.100 LDO PTHR17972
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.