DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mat89Ba and NOL6

Sequence 1:NP_650530.2 Gene:Mat89Ba FlyBaseID:FBgn0261286 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_075068.2 Gene:NOL6 HGNCID:19910 Length:1146 Species:Homo sapiens

Alignment Length:1175 Identity:397/1176 (34%)
Similarity:588/1176 (50%) Gaps:118/1176 (10%)


  Fly    19 GAARTGTQAIAHAGDHSDLDEP-------KPKIAKS------DPPSTAIPKKNNFKQREGTKNVK 70
            |.|..|.|.....|: .::.||       :.|.|.|      :||:..:.:.....:.|   ..|
Human     2 GPAPAGEQLRGATGE-PEVMEPALEGTGKEGKKASSRKRTLAEPPAKGLLQPVKLSRAE---LYK 62

  Fly    71 PPTLEEMKELRDTQNLFHSNLFKLQVKEMLEELQLKQKYTDFIENWLESF------------TAF 123
            .||.||:..||:|:.||||:|.:|||:|:|:|::|.:|..|.|:.:|...            |..
Human    63 EPTNEELNRLRETEILFHSSLLRLQVEELLKEVRLSEKKKDRIDAFLREVNQRVVRVPSVPETEL 127

  Fly   124 TRQ--LKDGLMERTHLEVPMKLSEKPTGFVFSKPTREPYLIGAAATGTLLGPKIVVDVALEMPKE 186
            |.|  |..|:....| :||..:.    |.....|..:..::|:...||.:.|.|.|||||.||:|
Human   128 TDQAWLPAGVRVPLH-QVPYAVK----GCFRFLPPAQVTVVGSYLLGTCIRPDINVDVALTMPRE 187

  Fly   187 SLHKEDYLNLRYDQKRALYLTYVTERMMESPDYAEDQFNFNYYANN-PLKPVLELIPVTKQVNKH 250
            .|..:|.||.||.:||||||.::...:.:.|.:....|:   |.|. .|||.|.|.|..|. .:.
Human   188 ILQDKDGLNQRYFRKRALYLAHLAHHLAQDPLFGSVCFS---YTNGCHLKPSLLLRPRGKD-ERL 248

  Fly   251 LQVRLFITAPLSSFKPGRFVPWNNNIRPSFYGDEWDEKD--PLPSTQHYNANVLFDLTLSENQAQ 313
            :.|||....|...|:|.|.:|..||:|.::|..:....|  |.|.|..||..||.|..|..:...
Human   249 VTVRLHPCPPPDFFRPCRLLPTKNNVRSAWYRGQSPAGDGSPEPPTPRYNTWVLQDTVLESHLQL 313

  Fly   314 LDKAFKSRRNFQDGLLLLKVWLRQRQLDIGYSGFGAHILAAFIVYLNTQRILHQSSSSYQVARTV 378
            |.....|.:..:||:.|||||||||:||.|..||...:::..:|:|.:.|.:|.:.|.|||.|:|
Human   314 LSTILSSAQGLKDGVALLKVWLRQRELDKGQGGFTGFLVSMLVVFLVSTRKIHTTMSGYQVLRSV 378

  Fly   379 WNQLANTDWT-KGISLSVAPIQT-EELNKFAEHYDVCFIDFTGQHNLCANIPLYLYQRVREEAKL 441
            ...||.||.| .||||.::...: ..|..|.:.:.|.|:|.:|..||||::....|.:|:.||:|
Human   379 LQFLATTDLTVNGISLCLSSDPSLPALADFHQAFSVVFLDSSGHLNLCADVTASTYHQVQHEARL 443

  Fly   442 AVELLNDMKLNSFPLIFMQKCPLYSRVDNILKISNYSCINQML-TLHSHPRIKYDFANYGYPQLL 505
            ::.||:....:.|.|:.|...|:....|::|.:...|.:.... .|...|.::.:..:| ....|
Human   444 SMMLLDSRADDGFHLLLMTPKPMIRAFDHVLHLRPLSRLQAACHRLKLWPELQDNGGDY-VSAAL 507

  Fly   506 HLLTELLKKGLAERVHSILPLETATAAWPVEKKAPVIGKY-----IQLGLILQPEHAYQVLNKGP 565
            ..||.||::||..|::.:.........|.:.:..|   |:     :.|||:|:||....||..||
Human   508 GPLTTLLEQGLGARLNLLAHSRPPVPEWDISQDPP---KHKDSGTLTLGLLLRPEGLTSVLELGP 569

  Fly   566 AANDDHEGAEEFRRFWGEKSNLRRFQDGSITEAVVWGTAQDSPAKKRLIVRQIVLHLLEHHLQLD 630
            .|  |...|.:||:|||.:|.|||||||:|.|||||..|  |.::||||..|:|.|||..|..:.
Human   570 EA--DQPEAAKFRQFWGSRSELRRFQDGAIREAVVWEAA--SMSQKRLIPHQVVTHLLALHADIP 630

  Fly   631 SKEVQYIGGELDQVYQLSPWFKVNKLKTKLPLGQDTDAEALSPHVIRCYDELARQLHGLNDLPLE 695
            ...|.|:||.||.:.|        .||.....|::....|     :||||:|:|.|.||..|||.
Human   631 ETCVHYVGGPLDALIQ--------GLKETSSTGEEALVAA-----VRCYDDLSRLLWGLEGLPLT 682

  Fly   696 IVSISGVSPIFRYCE---PQPVLPQALLVENRILASSI--------------QRVVIQLGQSGKW 743
            :.::.|..|:.||.|   |.||.|.....|.....||:              ..||..|..||:|
Human   683 VSAVQGAHPVLRYTEVFPPTPVRPAFSFYETLRERSSLLPRLDKPCPAYVEPMTVVCHLEGSGQW 747

  Fly   744 PTELGALRALKTAFLIEIGEKLEAQCRLHWVMSADGLLVLKQGYCFLIELAHNKELALLKQEVTE 808
            |.:..|::.::.||.:.:.|.|..|..|....:|....|||.|:.|.|.:|:.:|..:||:..:.
Human   748 PQDAEAVQRVRAAFQLRLAELLTQQHGLQCRATATHTDVLKDGFVFRIRVAYQREPQILKEVQSP 812

  Fly   809 RGITTYIDNAASRSLERQHYILPKVSGALHSLHQTYSAFGSTVLLAKRWLATQLLDDGLWPDMAT 873
            .|:.:..|.|||..|||....||.::.|||.|.|.:.||.....|||||:..|||.:| :.|.:.
Human   813 EGMISLRDTAASLRLERDTRQLPLLTSALHGLQQQHPAFSGVARLAKRWVRAQLLGEG-FADESL 876

  Fly   874 ELLVAHLF--QQRYAPQSIAAPQTGFIRFLQLLSHSDFNGELFLLNFNNSWQEQQIADLEHNYRS 936
            :|:.|.||  .:.:.|.|  :||.||:|||.|:|..|:......:|.||....::..::...:.:
Human   877 DLVAAALFLHPEPFTPPS--SPQVGFLRFLFLVSTFDWKNNPLFVNLNNELTVEEQVEIRSGFLA 939

  Fly   937 NRQSYPPLAVATSYDMQHAGRLWTSDQSPSQRVLGHVTRLARHALEIIETSLMSK----DLRFVR 997
            .|...|.:.:.|..|.:::  :||.| .||.::|..:..||..||.::|..||..    |:|.| 
Human   940 ARAQLPVMVIVTPQDRKNS--VWTQD-GPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTV- 1000

  Fly   998 PAQLFRASNEGYDLVIQFKPDLVPNSLSYDLGSPFVSF-----SQPNFS--LPRAGSDYIARIVG 1055
                ||...:.||::|:..|..:|.. ...:.||..||     |||..|  :|..|.|.....:.
Human  1001 ----FRPPLDIYDVLIRLSPRHIPRH-RQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLT 1060

  Fly  1056 LLRSAYSDFAAFFYNPHGGKELGIVWRPPTEFAAKPFKV--TELQACSPCGNKKVQVLK-ETLLE 1117
            .||.|:.|.|.|||:.|||:.:|::|: ||.|..:|||.  |:.:.....|.:.|.|.. |.:||
Human  1061 QLREAFGDLALFFYDQHGGEVIGVLWK-PTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILE 1124

  Fly  1118 DFKLL 1122
            ||.:|
Human  1125 DFAVL 1129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mat89BaNP_650530.2 Nrap 166..1130 CDD:281764 349/1002 (35%)
NOL6NP_075068.2 Nrap 165..1138 CDD:281764 349/1004 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C324280541
eggNOG 1 0.900 E1_KOG2054
Hieranoid 1 1.000
Homologene 1 1.000 H41505
Inparanoid 1 1.050 515 1.000 Inparanoid score I1283
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D148067at33208
OrthoFinder 1 1.000 FOG0003906
OrthoInspector 1 1.000 T1073205
orthoMCL 1 0.900 OOG5_128598
Panther 1 1.100 LDO PTHR17972
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1619
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.