DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mat89Ba and nol6

Sequence 1:NP_650530.2 Gene:Mat89Ba FlyBaseID:FBgn0261286 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001011358.1 Gene:nol6 XenbaseID:XB-GENE-994692 Length:1145 Species:Xenopus tropicalis

Alignment Length:1166 Identity:375/1167 (32%)
Similarity:581/1167 (50%) Gaps:140/1167 (12%)


  Fly    24 GTQAIAHAGDHSDLDEPKPKIAKSDPPSTAIPKKNNFKQREGTKNVKPPTLEEMKELRDTQNLFH 88
            |..|:..|.|..::..| .|::|||                   ..||||.:|:..|::|::|||
 Frog    36 GKSAVKRAPDADEVLRP-VKLSKSD-------------------LYKPPTNDELNRLKETEHLFH 80

  Fly    89 SNLFKLQVKEMLEELQLKQKYTDFIENWLESFTAFTRQLKD----GLMERTH---------LEVP 140
            :||.::|::|:|:|::||:|....|:.:|.........:.:    .|.::|.         |:||
 Frog    81 TNLLRMQIEELLQEVKLKEKRRKTIDGFLREINTLLGTIPETPQTDLTDQTWLPDSIKVPILQVP 145

  Fly   141 MKLSEKPTGFVFSKPTREPYLIGAAATGTLLGPKIVVDVALEMPKESLHKEDYLNLRYDQKRALY 205
            .::..|   |.|..|: ...::|:...||.:.|:|.||:|:.||:|.|..:|.||.||.:|||||
 Frog   146 YQVKGK---FCFLPPS-SIKVVGSYLLGTCIKPEINVDLAVTMPQEILQAKDNLNQRYSRKRALY 206

  Fly   206 LTYVTERMMESPDYAEDQFNFNYYANNPLKPVLELIPVTKQVNKHLQVRLFITAPLSSFKPGRFV 270
            |.::...:..:..::  ...|.|..:|.|||||.|.|..|. .|.:.||:.:..|...||..|..
 Frog   207 LAHIASHLANNELFS--SVKFTYMNSNHLKPVLLLRPYGKD-EKLVTVRIHVCPPPGFFKISRLY 268

  Fly   271 PWNNNIRPSFYGDEWDEKDPLPSTQHYNANVLFDLTLSENQAQLDKAFKSRRNFQDGLLLLKVWL 335
            |..||:|.::|.::..|....|.|.|||..:|.||||..:...|..........:|.:.||||||
 Frog   269 PNKNNVRTAWYTEQETEGVNEPPTPHYNNTILSDLTLEHHLHHLSNCASDFPGMKDAVALLKVWL 333

  Fly   336 RQRQLDIGYSGFGAHILAAFIVYLNTQRILHQSSSSYQVARTVWNQLANTDWT-KGISLSVAPIQ 399
            .|||||.||..|...:.|..|.||.::..:::..|.|||.|.....||.||.| .||:::.:...
 Frog   334 HQRQLDKGYGCFNGFLAAMLISYLLSKNKINKVMSGYQVLRNTLQFLATTDLTVNGITMATSTDS 398

  Fly   400 T-EELNKFAEHYDVCFIDFTGQHNLCANIPLYLYQRVREEAKLAVELLNDMKLNSFPLIFMQKCP 463
            : ..|:.|.|.:.|.|:|..|..||||::....|.:::.||:.::::|:|...:.|.|:.|...|
 Frog   399 SLPSLHDFHEAFQVVFVDPLGVVNLCADMTTNKYHQIQFEARESLKVLDDTSADGFHLLLMVPKP 463

  Fly   464 LYSRVDNILKISNYS-----C-----INQMLTLHSHPRIKYDFANYGYPQLLHLLTELLKKGLAE 518
            .....|::..::|.|     |     :||::....      |:.....|.:|    .:|.|||..
 Frog   464 FVRTFDHVFHLTNVSKLQGTCKKMKLLNQLIDQGG------DYLATSLPYVL----SILSKGLGP 518

  Fly   519 RVHSILPLETATAAWPVEKKAPVIGKY-----IQLGLILQPEHAYQVLNKGPAANDDHEGAEEFR 578
            ||..:.........|.:.::.   .|:     :.:||:|:.|....||.|||||  |...|.:||
 Frog   519 RVALLSHTLPHRPEWDIGEEP---AKHRDSSLLSVGLLLEAELHTSVLEKGPAA--DSSQALDFR 578

  Fly   579 RFWGEKSNLRRFQDGSITEAVVWGTAQDSPAKKRLIVRQIVLHLLEHHLQLDSKEVQYIGGELDQ 643
            .||||||.|||||||||.|||||  ...|..:||.:...||.:|||.|..:....:.|.|..||.
 Frog   579 AFWGEKSELRRFQDGSICEAVVW--PGSSLCEKRKVPELIVKYLLELHADIPESCISYTGNVLDC 641

  Fly   644 VYQLSPWFKVNKLKTKLPLGQD--TDAEALSPHVIRCYDELARQLHGLNDLPLEIVSISGVSPIF 706
            |               |..|::  |:.|.: ..:|:.||:|:|:|..|.||||.:.|:.|..|..
 Frog   642 V---------------LTRGKEAGTEEEKM-VGIIQSYDDLSRKLWNLTDLPLTVTSVQGTHPCL 690

  Fly   707 RYCE---PQPVLPQ----ALLVENRILASSIQ----------RVVIQLGQSGKWPTELGALRALK 754
            ||.:   |.||.|.    .||.|.:.|..:.:          :|:..:..|||||.:..|::.:|
 Frog   691 RYSDVFPPLPVKPDWSSYQLLREKKCLVPNPEKPCPAYVAPVKVICHMEGSGKWPQDKDAIKRVK 755

  Fly   755 TAFLIEIGEKLEAQCRLHWVMSADGLLVLKQGYCFLIELAHNKELALLKQEVTERGITTYIDNAA 819
            .||.|.:.|.|.||.:|....||....|.|.||.|.:::|:::|...:|:.||..|:..|.|...
 Frog   756 AAFQIRLAELLRAQHQLLCNPSATHTDVYKDGYVFRVQVAYHREPQYMKEIVTPEGMLKYQDTEE 820

  Fly   820 SRSLERQHYILPKVSGALHSLHQTYSAFGSTVLLAKRWLATQLLDDGLWPDMATELLVAHLF--Q 882
            |..||.:...||.::..||.|||.:.|||.|..:||||:.:|||.|. :.:...:|||||||  .
 Frog   821 SLQLELETLHLPSLTSTLHGLHQQHPAFGGTSRMAKRWIHSQLLGDS-FSEECVDLLVAHLFLHP 884

  Fly   883 QRYAPQSIAAPQTGFIRFLQLLSHSDFNGELFLLNFNNSWQEQQIADLEHNYRSNRQSYPPLAVA 947
            ..|:|.|  :||.||:|||.||:..|:.....::|.|...:.....::::::.|.|...|.:.:|
 Frog   885 APYSPPS--SPQVGFLRFLHLLATFDWKNSPLIVNLNGELKGPDYTEIQNDFISARAQLPVMFIA 947

  Fly   948 TSYDMQHAGRLWTSDQSPSQRVLGHVTRLARHALEIIETSLM----SKDLRFVRPAQLFRASNEG 1008
            |..|.:.:  |||..| |:.::|..:..|...:|..:|..||    |:|.:..     ||...:.
 Frog   948 TPKDKKDS--LWTKTQ-PTAQILQRLIVLCLESLRALEQQLMDPSGSQDYKMT-----FRPPLDL 1004

  Fly  1009 YDLVIQFKPDLVPNSLSYDLGSPFVSFSQ---------PNFSLPRAGSDYIARIVGLLRSAYSDF 1064
            ||::|:..|..:|.... .:..|..||.:         .:...|..|.|.:...:..||.||.:|
 Frog  1005 YDILIRLNPKQIPRHRE-AVDQPAKSFFRGLLKEGAQVKDLMFPVVGYDPVQCYLQELREAYGEF 1068

  Fly  1065 AAFFYNPHGGKELGIVWRPPTEFAAKPFKVTELQACSPCGNKKVQVL---KETLLEDFKLL 1122
            |.||::.|||..:|::|: |:.|..:|||.|.:......|.....:|   .|.::|||::|
 Frog  1069 ALFFHDKHGGDVIGVLWK-PSGFEPQPFKTTNMTGRVMDGKSAKPLLVPNVEAIVEDFEIL 1128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mat89BaNP_650530.2 Nrap 166..1130 CDD:281764 335/1012 (33%)
nol6NP_001011358.1 Nrap 165..1137 CDD:281764 335/1014 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C324283654
eggNOG 1 0.900 E1_KOG2054
Hieranoid 1 1.000
Homologene 1 1.000 H41505
Inparanoid 1 1.050 509 1.000 Inparanoid score I1208
OMA 1 1.010
OrthoDB 1 1.010 D148067at33208
OrthoFinder 1 1.000 FOG0003906
OrthoInspector 1 1.000 T1059288
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1619
TreeFam 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.