DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mat89Ba and nol6

Sequence 1:NP_650530.2 Gene:Mat89Ba FlyBaseID:FBgn0261286 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001154983.1 Gene:nol6 ZFINID:ZDB-GENE-030131-6294 Length:1153 Species:Danio rerio

Alignment Length:1184 Identity:370/1185 (31%)
Similarity:602/1185 (51%) Gaps:146/1185 (12%)


  Fly    40 PKPKIAKSDPPSTAIPKKNNFKQREGTKN----------------------VKPPTLEEMKELRD 82
            |:.::.:|.....|:.||....:.:..|.                      .|.||:||:.:|::
Zfish    16 PETEVPESSQKEEAMQKKTGKLRSKDPKRKAKDTVSDDGVLRPVKLSKKELYKAPTVEELNQLKE 80

  Fly    83 TQNLFHSNLFKLQVKEMLEELQLKQKYTDFIENWLESFTAF--------TRQLKDGLMERTHLEV 139
            .:||||.:|.|:|::|:|:|:.|.:.....::::::..|.|        ..:|.| :...:.:||
Zfish    81 AENLFHCSLLKMQMEELLKEVALSEHRKKLVDSFVQQVTEFLDCVPESEVMELND-VSWLSRVEV 144

  Fly   140 PMKL-SEKPTGFVFSKPTREPYLIGAAATGTLLGPKIVVDVALEMPKESLHKEDYLNLRYDQKRA 203
            |..| ....||....:......|:|:...||.:.|::.||:|:.:|...||..|.:|.||.:|||
Zfish   145 PFFLVPAAATGKFHMEAPASVSLVGSYPLGTCIKPRVCVDLAVIIPSSVLHPMDAINQRYPRKRA 209

  Fly   204 LYLTYVTERMMESPDYAEDQFNFNYYANNPLKPVLELIPVTKQVNKHLQVRLFITAPLSSFKPGR 268
            |||..:.:.:  |...|....:::....|.|:|||.:.|..|..:| :.:|:....|....||.|
Zfish   210 LYLAGLAQHL--SFLKAVGSMSYSCLHGNRLRPVLLVKPSGKDGDK-VTLRIHAIPPPDFLKPSR 271

  Fly   269 FVPWNNNIRPS-FYGDEWDEKDPL-PSTQHYNANVLFD-LTLSENQAQLDKAFKSRRNFQDGLLL 330
            |.|..||::.. |.|...:|:... |:|.|||:.||.| |.||..|. |.........|::|:.|
Zfish   272 FHPRKNNVKTEWFTGVAKEEQGAAGPATPHYNSTVLGDHLPLSHLQF-LSAVSAQCPAFREGVAL 335

  Fly   331 LKVWLRQRQLDIG---YSGFGAHILAAFIVYLNTQRILHQSSSSYQVARTVWNQLANTDWTK-GI 391
            ||||||.|:||.|   :.||.|.:|.|::  |:|.:: .::.::||:.|...:.||:||.|: ||
Zfish   336 LKVWLRHRELDQGAGCFCGFHASMLMAYL--LSTHKV-GKTMNAYQLFRNALHFLASTDLTENGI 397

  Fly   392 SLSVAP-IQTEELNKFAEHYDVCFIDFTGQHNLCANIPLYLYQRVREEAKLAVELLNDMKLNSFP 455
            :|:..| .:...|.:|...:.|.|:|.:|..||.|.:..:.|::::.||.|:::..:|..::.|.
Zfish   398 TLAKNPDSKAPALPEFHAAFSVVFVDPSGHLNLLAEMTTFTYKQIQHEASLSLKFWDDPTVDGFQ 462

  Fly   456 LIFMQKCPLYSRVDNILKISNY-----SC-----INQMLTLHSHPRIKYDFANYGYPQLLHLLTE 510
            .:.|....:....||:.::...     ||     :|:::. ||        .||....|..:|: 
Zfish   463 TLLMTPKSMIRTYDNVFQLGELVKLQASCKKLSLLNELMD-HS--------GNYVQTALPFILS- 517

  Fly   511 LLKKGLAERVHSILPLETATAAWPVEKKAPVIGKY-----IQLGLILQPEHAYQVLNKGPAANDD 570
            |||:||.||:|.::........|.|:...|   |:     :.:||:|..|||..||.:||.|  |
Zfish   518 LLKRGLGERIHLLVHSLPPDPEWSVKSPPP---KHKDQSPLNIGLLLNLEHALSVLERGPPA--D 577

  Fly   571 HEGAEEFRRFWGEKSNLRRFQDGSITEAVVWGTAQDSPAKKRLIVRQIVLHLLEHHLQLDSKEVQ 635
            :..|.|||:.||.:|.|||||||:|||||:|  :..|...|||::.:|:.|||..|..:....|:
Zfish   578 NPKAAEFRQLWGSRSELRRFQDGAITEAVLW--SGSSACDKRLVLLEIITHLLHLHADIPHSCVR 640

  Fly   636 YIGGELDQVYQLSPWFKVNKLKTKLPLGQDTDAEALSPHVIRCYDELARQLHGLNDLPLEIVSIS 700
            ::||:||.|      .||||...       |..|..|..|::.||:|:|:|..|..|||.|.|:.
Zfish   641 FVGGQLDDV------IKVNKELC-------TTGEEESLKVVQSYDDLSRKLWQLEGLPLSITSVQ 692

  Fly   701 GVSPIFRYCEPQPVLPQAL-------------LV--ENRILASSIQ--RVVIQLGQSGKWPTELG 748
            |.....||.:..|.:|..|             ||  |::...:.|.  :|::.:..|||||:|..
Zfish   693 GAHQALRYTQVFPPVPVRLDYSFFDRKKNHLGLVPREDKPCPTYITPIKVIVHMEGSGKWPSEQL 757

  Fly   749 ALRALKTAFLIEIGEKLEAQCRLHWVMSADGLLVLKQGYCFLIELAHNKELALLKQEVTERGITT 813
            |:|.:|.||.|.:||.|............:.:.|.|.|..|.:|:|:::|..:|::.:|..|:..
Zfish   758 AIRHIKAAFHICLGELLTKHHNYKCHAKPNYVDVWKDGLAFRVEVAYHREPHILRESLTPEGMLI 822

  Fly   814 YIDNAASRSLERQHYILPKVSGALHSLHQTYSAFGSTVLLAKRWLATQ-LLDDGLWPDMATELLV 877
            |.|||.:::||.:....|.::..||.|.|.:..||:...|||||||:| ||:|  ..:.|.:|:|
Zfish   823 YRDNAEAQALELETQHKPFLTSTLHGLQQQHGCFGAVCRLAKRWLASQFLLED--VREEAADLIV 885

  Fly   878 AHLF--QQRYAPQSIAAPQTGFIRFLQLLSHSDFNGELFLLNFNNSWQEQQIADLEHNYRSNRQS 940
            |.||  ...:.|.|  :||.||:|||.|||..|:.....::|.|.........|:::.:.|:|:|
Zfish   886 ASLFLHPAPFTPPS--SPQVGFLRFLHLLSSFDWKNNPLIVNLNGKLTVADTTDIKNEFVSSRES 948

  Fly   941 YPPLAVATSYDMQHAGRLWTSDQSPSQRVLGHVTRLARHALEIIETSLM----SKDLRFVRPAQL 1001
            .|.:.:|:..|.:.:  :||. :.||.::|.....||..:|.::|..|:    .:|:|.|     
Zfish   949 LPTMFIASPNDKKVS--IWTK-KVPSVQMLQRAVMLAAESLRVLENQLIDSSQKQDVRVV----- 1005

  Fly  1002 FRASNEGYDLVIQFKPDLVPNSLSYDLGSPFVSFSQPNF---------SLPRAGSDYIARIVGLL 1057
            ||...:.||::|...|..|| .|:..:.:|.:||.|..|         :||....:.:...:..|
Zfish  1006 FRPPLDAYDVLIHLIPQQVP-LLAKAVDAPALSFQQGTFKGEPATSGGALPVIDYNPVQLYLSEL 1069

  Fly  1058 RSAYSDFAAFFYNPHGGKELGIVWRPPTEFAAKPFKVTELQACSPCGNKKVQVL---KETLLEDF 1119
            |.|:.|.|.||::|.||..:.::|: |..|..:|||.:.:.|.....|..|..:   .|.:|:||
Zfish  1070 RDAFGDLALFFHDPFGGTVIAVLWK-PNAFEPRPFKTSLMNARRVEMNGDVATVVPNVEAILQDF 1133

  Fly  1120 KL----LLKDFYLR 1129
            ::    |:|...||
Zfish  1134 RIIGEGLVKKLELR 1147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mat89BaNP_650530.2 Nrap 166..1130 CDD:281764 335/1028 (33%)
nol6NP_001154983.1 Nrap 170..1146 CDD:281764 333/1027 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C324278404
eggNOG 1 0.900 E1_KOG2054
Hieranoid 1 1.000
Homologene 1 1.000 H41505
Inparanoid 1 1.050 475 1.000 Inparanoid score I1420
OMA 1 1.010
OrthoDB 1 1.010 D148067at33208
OrthoFinder 1 1.000 FOG0003906
OrthoInspector 1 1.000 T1052560
orthoMCL 1 0.900 OOG5_128598
Panther 1 1.100 LDO PTHR17972
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1619
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.