DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mat89Ba and Nol6

Sequence 1:NP_650530.2 Gene:Mat89Ba FlyBaseID:FBgn0261286 Length:1193 Species:Drosophila melanogaster
Sequence 2:XP_006225303.1 Gene:Nol6 RGDID:1308033 Length:1146 Species:Rattus norvegicus

Alignment Length:1142 Identity:386/1143 (34%)
Similarity:589/1143 (52%) Gaps:112/1143 (10%)


  Fly    43 KIAKSDPPSTAIPKKNNFKQREGTKNVKPPTLEEMKELRDTQNLFHSNLFKLQVKEMLEELQLKQ 107
            |.|:::.|:..:|:.....:.|   ..|.||.||:..||:|:.||||:|.:|||:|:|:|::|.:
  Rat    38 KRAQAEAPAEGLPQPVKLSREE---LYKEPTNEELNRLRETEILFHSSLLRLQVEELLKEVRLSE 99

  Fly   108 KYTDFIENWLESF------------TAFTRQ--LKDGLMERTHLEVPMKLSEKPTGFVFSKPTRE 158
            |..:.|:.:|:..            ...|.|  |..|:....| :||..:.   ..|.|..|: :
  Rat   100 KKKERIDAFLKEVIKRIQKVPPVPEAELTDQSWLPAGVRVPLH-QVPYAVK---GSFRFLPPS-Q 159

  Fly   159 PYLIGAAATGTLLGPKIVVDVALEMPKESLHKEDYLNLRYDQKRALYLTYVTERMMESPDYAEDQ 223
            ..::|:...||.:.|.|.|||.|.||:|.|..:|.||.||.:|||||||::...:...|.:.  .
  Rat   160 ITIVGSYPLGTCMRPDINVDVVLTMPREILQDKDGLNQRYFRKRALYLTHLAYHLARDPLFG--S 222

  Fly   224 FNFNYYANNPLKPVLELIPVTKQVNKHLQVRLFITAPLSSFKPGRFVPWNNNIRPSFY-GDEWDE 287
            ..|:|.:...|||.|.|.|..|. .:.:.|||:...||..|:|.|.:|..||:|.::| |....:
  Rat   223 VRFSYPSGCHLKPSLLLRPHGKD-ERLVTVRLYPCPPLDFFRPCRLLPTKNNVRSAWYRGQSCPD 286

  Fly   288 KDPL-PSTQHYNANVLFDLTLSENQAQLDKAFKSRRNFQDGLLLLKVWLRQRQLDIGYSGFGAHI 351
            ...| |.|.|||..:|.|..|..:...|.....|.:..:||:.|||||||||:||.|..||...:
  Rat   287 YASLEPPTPHYNTWILQDTALEAHMHLLSSVLASAQGLKDGVALLKVWLRQRELDKGLGGFNGFL 351

  Fly   352 LAAFIVYLNTQRILHQSSSSYQVARTVWNQLANTDWT-KGISLSVAPIQT-EELNKFAEHYDVCF 414
            ::..:.:|.::|.:|.:.|.|||.|:|...||.||.| .|||.|::...: ..:..|.:.:.|.|
  Rat   352 ISMLVAFLVSKRKIHTTMSGYQVLRSVLQFLATTDLTINGISFSLSSDPSLPSVADFHQLFAVVF 416

  Fly   415 IDFTGQHNLCANIPLYLYQRVREEAKLAVELLNDMKLNSFPLIFMQKCPLYSRVDNILKISNYSC 479
            :|.:|:.||||::....|.:|:.||:|::.||:....:.|.|:.|...|:....|:::.:...|.
  Rat   417 VDPSGRLNLCADVTASTYNQVQYEAELSMALLDSKADDGFQLLLMTPKPMIQAFDHVVHLRPLSR 481

  Fly   480 INQML-TLHSHPRIKYDFANYGYPQLLHLLTELLKKGLAERVHSILPLETATAAWPVEKKAPVIG 543
            :.... .|...|.::.:..:| ....|..||.:|.:||..|:|.:.........|.:.:..|   
  Rat   482 LQAACHQLKLWPELQDNGGDY-VSAALGPLTNILVQGLGCRLHLLAHSRPPVPEWAINQDPP--- 542

  Fly   544 KY-----IQLGLILQPEHAYQVLNKGPAANDDHEGAEEFRRFWGEKSNLRRFQDGSITEAVVWGT 603
            |:     :.|||:.:||....|::.||.|  |...|.|||:|||.:|.|||||||:|.|||||  
  Rat   543 KHKDAGTLTLGLLFRPEGLTSVIDLGPEA--DRPEAAEFRQFWGSRSELRRFQDGAIREAVVW-- 603

  Fly   604 AQDSPAKKRLIVRQIVLHLLEHHLQLDSKEVQYIGGELDQVYQLSPWFKVNKLKTKLPLGQDTDA 668
            ..:|.::||||..|:|.|||..|..:....:.|:||.||.:.|       ...:|     ..|..
  Rat   604 EAESLSEKRLIPHQVVTHLLALHADIPDTCIHYVGGFLDALIQ-------GPRET-----SSTGE 656

  Fly   669 EALSPHVIRCYDELARQLHGLNDLPLEIVSISGVSPIFRYCE---PQPVLPQALLVENR--ILAS 728
            |||: ..:||||:|:|.|.||.||||.:.::.|..|:.||.|   |.||.| |....||  .|||
  Rat   657 EALA-LAVRCYDDLSRLLWGLEDLPLTVSAVQGAHPVLRYTEVFPPAPVRP-AYSFYNRHQELAS 719

  Fly   729 SIQR-------------VVIQLGQSGKWPTELGALRALKTAFLIEIGEKLEAQCRLHWVMSADGL 780
            .:.|             ||..|..||:||.:..|::.::.||.:.:.|.|..|.||....:|...
  Rat   720 LLPRLDKPCPAYVEPMTVVCHLEGSGQWPQDAEAVQRVRAAFQLRLAEVLTQQHRLQCRATATHT 784

  Fly   781 LVLKQGYCFLIELAHNKELALLKQEVTERGITTYIDNAASRSLERQHYILPKVSGALHSLHQTYS 845
            .|||.|:.|.|.:|:.:|..:||...:..|:.:..|..||..|||...:||.::.|||.|.|.|.
  Rat   785 DVLKGGFVFRIRVAYQREPQILKVVRSPEGMISMRDTPASLRLERDTRLLPLLTSALHGLQQQYP 849

  Fly   846 AFGSTVLLAKRWLATQLLDDGLWPDMATELLVAHLF--QQRYAPQSIAAPQTGFIRFLQLLSHSD 908
            ||.....|||||:..|||.:| :.|.:.:|:.|.||  .:.:.|.|:  ||.||:|||.|:|..|
  Rat   850 AFSGVARLAKRWVRAQLLGEG-FTDESLDLVAASLFLHPEPFTPPSV--PQVGFLRFLYLISTFD 911

  Fly   909 FNGELFLLNFNNSWQEQQIADLEHNYRSNRQSYPPLAVATSYDMQHAGRLWTSDQSPSQRVLGHV 973
            :.....::|.|:....::..::..::.:.|...|.:.:.|..|.:.:  :||.| .||.::|..:
  Rat   912 WKNNPLIVNLNSELTAEEQVEIRSSFLAARTQLPVMVIVTPQDRRSS--VWTQD-GPSAQILQQL 973

  Fly   974 TRLARHALEIIETSLMSK----DLRFVRPAQLFRASNEGYDLVIQFKPDLVPNSLSYDLGSPFVS 1034
            ..||..||.|:|..||..    |:|.|     ||...:.||::|...|..:|.. ...:..|..|
  Rat   974 VSLAAEALPILEKQLMDPRGPGDIRTV-----FRPPFDIYDVLIHLTPRHIPRH-RQAVDPPAAS 1032

  Fly  1035 FSQ-------PNFSLPRAGSD----YIARIVGLLRSAYSDFAAFFYNPHGGKELGIVWRPPTEFA 1088
            |.:       |:..:|..|.|    |:|:    ||.|:.|.|.|||:.|||:.:|::|: |:.|.
  Rat  1033 FCRGLVTEPGPSSLMPVLGYDPPQLYLAQ----LREAFGDLALFFYDQHGGEVIGVLWK-PSSFQ 1092

  Fly  1089 AKPFKVTELQA--CSPCGNKKVQVLK-ETLLEDFKLL 1122
            .:|||.:.|:.  ....|.:.|.|.. |.:||||.:|
  Rat  1093 PQPFKASSLKGRMVVSRGGELVTVPNIEAILEDFAVL 1129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mat89BaNP_650530.2 Nrap 166..1130 CDD:281764 347/1006 (34%)
Nol6XP_006225303.1 Nrap 165..1138 CDD:281764 347/1008 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C324284363
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H41505
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D148067at33208
OrthoFinder 1 1.000 FOG0003906
OrthoInspector 1 1.000 T1086847
orthoMCL 1 0.900 OOG5_128598
Panther 1 1.100 LDO PTHR17972
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.