DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mat89Ba and SPBC776.08c

Sequence 1:NP_650530.2 Gene:Mat89Ba FlyBaseID:FBgn0261286 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_596323.1 Gene:SPBC776.08c PomBaseID:SPBC776.08c Length:1097 Species:Schizosaccharomyces pombe

Alignment Length:1193 Identity:282/1194 (24%)
Similarity:480/1194 (40%) Gaps:274/1194 (23%)


  Fly    70 KPPTLEEMKELRDTQNLFHSNLFKLQVKEMLEELQLKQKYTDFIENWLESFTAFTRQLKD----- 129
            |...|.|.||..:...|..::.|:|::.|::.|:.::.||       ......|..::||     
pombe    40 KRKKLNEKKENLEDLTLLKTSAFELKLNELIREISVRGKY-------FRHANTFVEKIKDLIFKT 97

  Fly   130 GLMERTHLEVPMKLSEKPTGFVFSKPTREPYLIGAAAT---GTLLGPKIVV-------------- 177
            .::..|:.....|..||....:.  |..||  :.|..|   .:.:.||.|.              
pombe    98 PVIPETNFWSACKNLEKDKKVIV--PLAEP--LSAKDTNLRASFVPPKTVTPGIFSCSNKFFLNP 158

  Fly   178 -----DVALEMPKESLHKEDYLNLRYDQKRALYLTYVTERMMESPDYAEDQFNFNYYANNPLKPV 237
                 |:.||:|:....::||||.||.:|||.|||.:.:.::|:.. .|.:..|..:.::..:|:
pombe   159 DGWSYDLFLEIPESIFTQKDYLNGRYFRKRAFYLTCIAKHLLENLG-NEVKLEFVAFNDDIRRPI 222

  Fly   238 LELIPVTK---QVNKHLQVRLFITAPLSSFKPGRFVPWNNNIRPSFYGDEWDEKDPLPSTQHYNA 299
            |.::|.:|   ...|...|.|..|. ...|...:.:|..|.||      ::.|.:.|..|..||.
pombe   223 LAILPESKGFAATGKRFTVFLIPTV-RQIFPVSKLLPHKNAIR------DFMEHEELKPTPFYNN 280

  Fly   300 NVLFDLTLSENQAQLDKAFKSRRNFQDGLLLLKVWLRQRQLDIGYS------GFGA---HILAAF 355
            :||.:..|...: .|.|.:.....|.|...|...||..|    |:|      |||.   ::|.|.
pombe   281 SVLEEQNLLFYR-DLVKKYSVNPQFLDACGLGSTWLNMR----GFSSSIHSNGFGLLEWYVLMAL 340

  Fly   356 IV---------YLNTQRILHQSSSSYQVARTVWNQLANTDWTKGISLSVAPIQTEELN-KFAEHY 410
            ::         .|||          |..|...:..:.....:|.::.::..:..:..| |....:
pombe   341 LMSSTGLPAGNVLNT----------YLTAAQFFKSMLQFLSSKNLTSTLFKLNADSSNLKIGNGH 395

  Fly   411 DVCFIDFTGQHNLCANIPLYLYQRVREEAKLAVELLNDMKLNSFPLIFMQKCPLYSRVDNILKIS 475
            ....||.....||...:....::..:...:..:.||::.                         :
pombe   396 LPTLIDCNTGFNLLGKMKQSFFEYFQASCRHTLNLLDEN-------------------------A 435

  Fly   476 NYSCINQMLTLHSHPRIKYDFA-------------NY--------GYPQLLHLLTELLKKGLAER 519
            ||:.....:|..:.|.:::|.:             |:        .|...|....:||:..|.:|
pombe   436 NYNFSKIFITHVNVPALEFDVSGCIPLEPKELEDPNFCRKTDLDSPYSLYLEYTWDLLQHALGDR 500

  Fly   520 VHSILPLETATAAWPVEK----KAPVIGKYIQLGLILQPEHAYQVLNKGPAANDDHEGAEEFRRF 580
            |..|:...:...:..:.:    |.|   |.|..||:|.|:...::::.||:. ||..|:::||.|
pombe   501 VCQIILYSSICTSCSINESLKTKLP---KLISFGLLLNPDALLRLVDIGPSP-DDTVGSQKFREF 561

  Fly   581 WGEKSNLRRFQDGSITEAVVWGTAQDSPAKKRLIVRQIVLHLLEHHLQLDSKEVQYIGGEL-DQV 644
            |||.|.||:|::|||.|:|.|..:  ||.::..|.::|:.|:|..||          |..: |:|
pombe   562 WGEVSELRKFKNGSIAESVYWECS--SPDERIRIPQRIIRHILNRHL----------GNNVGDRV 614

  Fly   645 YQLSPWFKVNKLKTKLPLGQDTDAEALSPHVIRCYDELARQLHGLNDLPLEIVSISGVSPIFRY- 708
            ...:..|:| .:.:|:....||..|.:.  |:..|:|..:.|..|:|:||.|..|.......|| 
pombe   615 SFRNEKFRV-YVHSKISPNTDTYNEYVP--VMEAYNEAVKSLINLSDIPLSIAEILPADESLRYS 676

  Fly   709 -----------CEPQPVLPQALLVENRILASSIQRVVIQLGQSGKWPTELGALRALKTAFLIEIG 762
                       |.|..                   ||.|...|.|||.||..::..|.|||::|.
pombe   677 SSSVPFYESSTCAPID-------------------VVFQFESSSKWPDELEGIQRTKIAFLLKIA 722

  Fly   763 EKLEAQCRLHWVMSADGL--------------LVLKQGYCFLIELAHNKELALLKQEVTERGITT 813
            |.|||...:.  .::.||              ::....:.|...|.:::|:...|.  .||..:|
pombe   723 ELLEALDNVE--RASVGLENTDNPTHNCCFLQVLFSNNFTFRYRLRNDREIFFWKS--LERNPST 783

  Fly   814 YIDNAASRSL---ERQHYILPKVSGALHSLHQTYSAFGSTVLLAKRWLATQLLDDGLWPDMATEL 875
            .:  :|.:.|   |.....:|:.:.|:.::.|.:.::...|.|||.|..:.||.|.: .|...||
pombe   784 KL--SAQKGLYAYEHMFQFIPRHTLAIQAICQAHRSYSMAVRLAKHWFYSHLLTDHV-TDEVIEL 845

  Fly   876 LVAHLFQQRYAPQSIAAPQTGFIRFLQLLSHSDFNGELFLLNFN---------------NSWQEQ 925
            |||.::....:.::.::.:|.|.|.|..|:|.|:..:..::|.|               .|.::|
pombe   846 LVASVYINSSSWRTTSSGETSFCRMLHFLAHWDWRFDPLIINSNGKLPHDVRHQATEKLESIRKQ 910

  Fly   926 QIADLEHNYRSNRQSYPPLAVATSYDM--QHAGRLWTSDQSPSQRVLGHVTRLARHALEIIETSL 988
            .:| :.||      :|   .:.|.||.  .|.|.     ..||:.:...:|.|||.:|     |.
pombe   911 DVA-IAHN------AY---YIITDYDFDGNHIGY-----YKPSKIIANRITSLARASL-----SE 955

  Fly   989 MSKDLRFVRPAQLFRASNEGYDLVIQFKPDLVP-----NSLSYDLGSPFVSFSQPNFSLPRAGSD 1048
            :.||....:  .:|::|.:.|.:||....:.:|     |...|.        :..|.|..|.|.:
pombe   956 LLKDTPNYK--SIFKSSLDIYHVVIDVNINKLPMYRESNLTKYK--------NLQNMSSERPGFE 1010

  Fly  1049 YIARIVGLLRSAYSDFAAFFYNPHGGKELGIVW-------RPPTEFAAKPFKVTE-----LQACS 1101
            .|...|..|...:.|..:||||....|.:..|:       ||.......||||.:     |.|..
pombe  1011 PITEFVKELHRCFEDTISFFYNKKNPKVVTGVFNPRILANRPYRTNIDYPFKVVDKDTVVLDADV 1075

  Fly  1102 PCGNKKVQVLKETLLEDFKLLLK 1124
            .|  ::::.:...|:...:|.||
pombe  1076 VC--EEIRQVGGDLIRSIQLQLK 1096

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mat89BaNP_650530.2 Nrap 166..1130 CDD:281764 259/1093 (24%)
SPBC776.08cNP_596323.1 Nrap 158..1093 CDD:281764 252/1060 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H41505
Inparanoid 1 1.050 212 1.000 Inparanoid score I928
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003906
OrthoInspector 1 1.000 T1124798
orthoMCL 1 0.900 OOG5_128598
Panther 1 1.100 LDO PTHR17972
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1619
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.