DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mat89Ba and Nol6

Sequence 1:NP_650530.2 Gene:Mat89Ba FlyBaseID:FBgn0261286 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_631982.2 Gene:Nol6 MGIID:2140151 Length:1152 Species:Mus musculus

Alignment Length:1157 Identity:384/1158 (33%)
Similarity:590/1158 (51%) Gaps:139/1158 (12%)


  Fly    40 PKPKIAKSDPPSTAIPKKNNFKQREGTKNVKPPTLEEMKELRDTQNLFHSNLFKLQVKEMLEELQ 104
            |..|.|:::||:..:.:..|..:.|   ..|.||.||:..||:|:.||||.|.:|||:|:|:|::
Mouse    44 PSRKRARTEPPAEGLLQPVNLSREE---LYKEPTNEELNRLRETEILFHSTLLRLQVEELLKEVR 105

  Fly   105 LKQKYTDFIENWLESFT------------AFTRQ--LKDGLMERTHLEVPMKLSEKPTGFVFSKP 155
            |.:|..:.|:|:|:..|            ..|.|  |..|:....| :||..:.    |....:|
Mouse   106 LSEKKKERIDNFLKEVTKRIQKVPPVPEAELTDQSWLPAGVRVPLH-QVPYAVK----GSFRFRP 165

  Fly   156 TREPYLIGAAATGTLLGPKIVVDVALEMPKESLHKEDYLNLRYDQKRALYLTYVTERMMESPDYA 220
            ..:..::|:....|.:.|.|.||||:.||:|.|..:|.||.||.:||||||.::...:.:.|.::
Mouse   166 PSQITVVGSYLLDTCMRPDINVDVAVTMPREILQDKDGLNQRYFRKRALYLAHLAYHLAQDPLFS 230

  Fly   221 EDQFNFNYYANNPLKPVLELIPVTKQVNKHLQVRLFITAPLSSFKPGRFVPWNNNIRPSFY-GDE 284
              ...|:|.:...|||.|.|.|..|. .:.:.|||....||..|:|.|.:|..||:|.::| |..
Mouse   231 --SVRFSYMSGCHLKPSLLLRPHGKD-ERLVTVRLLPCPPLDFFRPCRLLPTKNNVRSAWYRGQS 292

  Fly   285 WDEKDPLPSTQHYNANVLFDLTLSENQAQLDKAFKSRRNFQDGLLLLKVWLRQRQLDIGYSGFGA 349
            ..:.:  |.|.|||..:|.|:.|..:...|.....|.:..:||:.|||||||||:||.|..||..
Mouse   293 CPDYE--PPTPHYNTWILQDVALETHMHLLASVLGSAQGLKDGVALLKVWLRQRELDKGLGGFNG 355

  Fly   350 HILAAFIVYLNTQRILHQSSSSYQVARTVWNQLANTDWT-KGISLSVAPIQT-EELNKFAEHYDV 412
            .|::..:.:|.::|.:|.:.|.|||.|:|...||.||.| .|||.|::...: ..|.:|.:.:.|
Mouse   356 FIISMLVAFLVSKRKIHTTMSGYQVLRSVLQFLATTDLTINGISFSLSSDPSLPTLAEFHQLFAV 420

  Fly   413 CFIDFTGQHNLCANIPLYLYQRVREEAKLAVELLNDMKLNSFPLIFMQKCPLYSRVDNILKISNY 477
            .|:|.:|:.||||::....|.:|:.||:|::.||:....:.|.|:.|...|:....|::      
Mouse   421 VFVDPSGRLNLCADVTASTYNQVQYEAELSMALLDSKADDGFQLLLMTPKPMIQAFDHV------ 479

  Fly   478 SCINQMLTLHSHPRIKYDFANYG---YPQL-----------LHLLTELLKKGLAERVHSILPLET 528
                    :|.||..:...:.:.   :|:|           |..||.:|.:||..|:|.:.....
Mouse   480 --------VHLHPLSRLQASCHQLKLWPELQDNGGDYVSAALGPLTNILVQGLGCRLHLLAHSRP 536

  Fly   529 ATAAWPVEKKAPVIGKY-----IQLGLILQPEHAYQVLNKGPAANDDHEGAEEFRRFWGEKSNLR 588
            ....|.:.:..|   |:     :.||.:.:||....|::.||.|  |...|.:||:|||.:|.||
Mouse   537 PVPEWSINQDPP---KHKDAGTLTLGFLFRPEGLTSVIDLGPEA--DKPEAADFRQFWGTRSELR 596

  Fly   589 RFQDGSITEAVVWGTAQDSPAKKRLIVRQIVLHLLEHHLQLDSKEVQYIGGELDQVYQLSPWFKV 653
            |||||:|.|||||  ..:|..:||||..|:|.|||..|..:....:||:||.||.:.|       
Mouse   597 RFQDGAIREAVVW--EAESLFEKRLIPHQVVTHLLALHADIPDTCIQYVGGFLDALIQ------- 652

  Fly   654 NKLKTKLPLGQDTDAEALSPHVIRCYDELARQLHGLNDLPLEIVSISGVSPIFRYCE---PQPVL 715
            |..:.     ..|..|||: ..:||||:|:|.|.||..|||.:.::.|..|:.||.|   |.||.
Mouse   653 NPKEI-----SSTGEEALA-LAVRCYDDLSRLLWGLEGLPLTVSAVQGAHPVLRYTEVFPPAPVR 711

  Fly   716 PQALLVENRI--LASSIQR-------------VVIQLGQSGKWPTELGALRALKTAFLIEIGEKL 765
            | |....||:  |||.:.|             ||..|..||:||.:..|::.::.||.:.:.|.|
Mouse   712 P-AYSFYNRLQELASLLPRPDKPCPAYVEPMTVVCHLEGSGQWPQDAEAVQRVRAAFQLRLAEVL 775

  Fly   766 EAQCRLHWVMSADGLLVLKQGYCFLIELAHNKELALLKQEVTERGITTYIDNAASRSLERQHYIL 830
            ..:.||....:|....|||.|:.|.|.:|:.:|..:||:..:..|:.:..|..||..|||...:|
Mouse   776 TQEHRLQCCATATHTDVLKDGFVFRIRVAYQREPQILKEVRSPEGMVSLRDTPASLRLERDTKLL 840

  Fly   831 PKVSGALHSLHQTYSAFGSTVLLAKRWLATQLLDDGLWPDMATELLVAHLF--QQRYAPQSIAAP 893
            |.::.|||.|.|.|.|:.....|||||:..|||.:| :.|.:.:||.|.||  .:.:.|.|:  |
Mouse   841 PLLTSALHGLQQQYPAYSGVARLAKRWVRAQLLGEG-FTDESLDLLAASLFLHPEPFTPPSV--P 902

  Fly   894 QTGFIRFLQLLSHSDFNGELFLLNFNNSWQEQQIADLEHNYRSNRQSYPPLAVATSYDMQHAGRL 958
            |.||:|||.|:|..|:.....::|.|.....::...:..::.:.|...|.:.:.|..|.:.:  :
Mouse   903 QVGFLRFLYLVSTFDWKNNPLIVNLNGELTAEEQVGIRSSFLAARTQLPVMVIITPQDRRSS--V 965

  Fly   959 WTSDQSPSQRVLGHVTRLARHALEIIETSLMSK----DLRFVRPAQLFRASNEGYDLVIQFKPDL 1019
            ||.| .||.::|..:..||..||.|:|..||..    |:|.|     ||...:.||::|...|..
Mouse   966 WTQD-GPSAQILQQLVSLAAEALPILEKQLMDPRGPGDIRTV-----FRPPFDMYDVLIHLTPRH 1024

  Fly  1020 VPNSLSYDLGSPFVSFSQ-------PNFSLPRAGSD----YIARIVGLLRSAYSDFAAFFYNPHG 1073
            :|.. ...:..|..||.:       |:..:|..|.|    |:|:    ||.|:.|.|.|||:.||
Mouse  1025 IPRH-RQAVDPPVASFCRGLLAEPGPSSLMPVLGYDPPQLYLAQ----LREAFEDLALFFYDQHG 1084

  Fly  1074 GKELGIVWRPPTEFAAKPFKVTELQ---ACSPCGNKKVQVLKETLLEDFKLL 1122
            |:.:|::|: |:.|..:|||.:.::   ..|..|...:....|.:||||.:|
Mouse  1085 GEVIGVLWK-PSSFQPQPFKASSIKGRMVVSQGGELVMLPNIEAILEDFAVL 1135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mat89BaNP_650530.2 Nrap 166..1130 CDD:281764 342/1018 (34%)
Nol6NP_631982.2 Nrap 174..1144 CDD:281764 342/1020 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C324285834
eggNOG 1 0.900 E1_KOG2054
Hieranoid 1 1.000
Homologene 1 1.000 H41505
Inparanoid 1 1.050 526 1.000 Inparanoid score I1218
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003906
OrthoInspector 1 1.000 T1083280
orthoMCL 1 0.900 OOG5_128598
Panther 1 1.100 LDO PTHR17972
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1619
TreeFam 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.