DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mat89Ba and nol-6

Sequence 1:NP_650530.2 Gene:Mat89Ba FlyBaseID:FBgn0261286 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_493972.3 Gene:nol-6 WormBaseID:WBGene00021789 Length:1058 Species:Caenorhabditis elegans

Alignment Length:1202 Identity:272/1203 (23%)
Similarity:486/1203 (40%) Gaps:305/1203 (25%)


  Fly    89 SNLFKL--------QVKEMLE-ELQLKQKYTDFIENWLESFTAFTRQLKDGLMERTHLEVPMKLS 144
            ||.|||        ..|:::| :.|:.||    |:|.||:       .|:|          .|:.
 Worm    11 SNAFKLLCEDTAPKSNKKLIEKQRQIAQK----IKNVLET-------SKNG----------PKIQ 54

  Fly   145 EKPTGFVFSKPTREP--YLIGAA-ATGTLL------GPKIVV------DVALEMPKESLHKEDYL 194
            .|...|......:.|  :|..|. ||.:.:      .||.:|      .:.:|:|.::|...|:|
 Worm    55 YKNLDFWTEFDVKHPLHHLQKAVDATSSSIPEFQWTPPKSIVITEKGQQIFIEIPPKALGNRDFL 119

  Fly   195 NLRYDQKRALYLTYVTERM---------------MESPDYAE---DQFNFNYYANNPLKPVLELI 241
            ||.|..||..:..:|...:               .:.|.:|:   |.....:|.     |.|.  
 Worm   120 NLTYAAKRGHFACHVARLLSGKFEKVEFTAGGAHRDDPIFADILVDGVRIGFYC-----PELA-- 177

  Fly   242 PVTKQVNKHLQVRLFITAPLSSFKPGRFVPWNNNIRP-SFYGDEWDEKDPLPSTQHYNANVLFDL 305
                                   |..||.|...|:|| :.:.|.:.|.:  .:|..:|..:|:.:
 Worm   178 -----------------------KTKRFAPNIGNLRPATIFEDLFKETE--IATPKFNQRMLWSI 217

  Fly   306 TLSENQAQLDKAFKSRRNFQDGLLLLKVWLRQRQLDIGYSGFGAHILAAFIVYLNTQRILHQSSS 370
            ...|...:::|..|:::..:..:.||..:...|.|....:..   ||.|.:|.|.....:.::..
 Worm   218 LELEIAQEMEKELKAQKTARLAIFLLGNFFENRHLQHAITPI---ILTARVVRLVKNGKITENQE 279

  Fly   371 SYQVARTVWNQLANTDWTKGISLSVAPIQTE-ELNKFAEHYDVCFIDFTGQHNLCANIPLYLYQR 434
            ...|.|.::.....  |:......|..::.: ::.::::.:||..:  ....||.:|:.....:|
 Worm   280 ILTVLRVIFEDFIT--WSADDVEFVDSVEDDVDVEEYSQLFDVNLV--WKNLNLASNLTKNYMER 340

  Fly   435 VREEAKLAVELLNDMKLNSFPLIFMQKCPLYSRVDNILK-------------------ISNYSCI 480
            :::|..:...||.  ::.:|..||::|.|:::..|::.:                   |.|...|
 Worm   341 MKKELTICYPLLG--QVYAFDPIFIEKLPVFAHYDHVARLHINISQLAEHLVEFGIDSIDNRDVI 403

  Fly   481 NQMLTLHSHPRI------KYDFANYGYPQLLHLLTELLKK---GLAE-----RVHSILPLETATA 531
            ::.:....| :|      :|||..      :|.::...:|   .|:|     |..:.|....:|:
 Worm   404 HKFVLSFEH-KIEQTMSERYDFVG------IHDISSNAEKSTWSLSEYPEKYRQKTYLIGFRSTS 461

  Fly   532 AWPVEKKAPVIGKYIQLGLILQPEHAYQVLNKGPAA--ND-----DH--------------EGAE 575
            .|    |.|                    |..||.|  ||     |:              |..:
 Worm   462 GW----KNP--------------------LTVGPPAQTNDAKGLLDYKLQVFRLKISIFLLENRK 502

  Fly   576 EFRRFWGEKSNLRRFQDGSITEAVVWGTAQDSPAKKRLIVRQIVLHLLEHHLQLDSKEVQYIGGE 640
            :||..|.|.|.||:|.|..|.|.|||   .:.|::|   |.:.||              |::   
 Worm   503 KFRELWKETSELRKFADTRICECVVW---SEKPSEK---VPRAVL--------------QFV--- 544

  Fly   641 LDQVYQL-SPWFKVNKLKTKLPLGQDTDAEALSPH-------VIRCYDELARQLHGLNDLPLEIV 697
            |.:::.| :..|....|.:     ..|.|||...|       |.:.|.:|:..|.||..|||.|.
 Worm   545 LQKMFSLPATCFSWRALTS-----SSTSAEADQQHEKKSQEAVFKAYTDLSTVLRGLKGLPLMIT 604

  Fly   698 SISGVSPIFRYCEP-------------------QPVLPQALLVENRILASSIQRVVIQLGQSGKW 743
            ::.|:|...|..||                   ..|||:   :....|.:....|.|:|..||||
 Worm   605 NVHGISGYLRGSEPAYPSVFAATSSTNKSSEDQHYVLPE---IGKIPLFTPTVTVHIKLEYSGKW 666

  Fly   744 PTELGALRALKTAFLIEIGEKLEAQCRLHWVMSADGLLVLKQGYCFLIELAHNKELALLKQEVTE 808
            ..::.|:|.|.::|.::|.|:|..|.:|..|.:.|.|.:||.|..|.|.:.:::.|.:|:::|.:
 Worm   667 GNDVEAIRRLTSSFYVKIAERLREQHKLTAVPTIDQLFILKSGIVFKIVVVNDRILTILEEDVQK 731

  Fly   809 RGITTYIDNAASR----------SLERQHYIL-PKVSGALHSLHQTYSAFGSTVLLAKRWLATQL 862
                 ..|:.|||          |:.::.:|. |.:..:|.|...::..|||||.|.|:||.::.
 Worm   732 -----LKDSGASRIESSIQGMRLSMWKKKFISEPLLQLSLQSFSTSHKFFGSTVQLFKKWLGSKF 791

  Fly   863 LDDGLWPDMATELLVAHLFQQR--YAPQSIAAPQTGFIRFLQLLSHSDFNGELFLLNF-NNSWQE 924
            |......|...||||.....::  ..|||   ..:.|.|.|.|:|...::....:::| ...:.|
 Worm   792 LSGHHLNDHIIELLVVAAIGKKGQVPPQS---TWSSFCRLLSLISTHPWSARPLIVDFGTKGFSE 853

  Fly   925 QQIADLEHNYRSNRQSYPPLAVATSYDMQHAGRLWTSDQSPSQRVLGHVTRLARHALEI------ 983
            .:.:.||..:...|...||:.|.  |:..|.|..:|. ::|...||..:..:||.||::      
 Worm   854 DERSKLEEKFIKMRPILPPMVVI--YEEDHLGSKFTR-ENPQGIVLNRLVAVAREALKMMEKQAF 915

  Fly   984 ------IETSLMSKDLRFVRPAQLFRASNEGYDLVIQFKPDLVPNSLSYDLGSPFVSFSQPNFSL 1042
                  :||||::::|             ..||.:|..:|..|....:.....|....|:....:
 Worm   916 GEKSIEMETSLLTENL-------------SPYDAIINLEPCAVVRKKALMERKPPAETSKFRQKI 967

  Fly  1043 PRAGSDYIARIVGLLRSAYSDFAAFFYNPHGGKELGIVWRPPTEFAAKPFKVTELQACSPCGNKK 1107
            |....|.:..:|..|.:::...|.||||.:||..:|::::|..:  ..|.|::.........:..
 Worm   968 PVVELDPVDELVYQLNNSFQQVAMFFYNKYGGHHIGVMFKPQED--EVPAKISRCSLHKSVSDST 1030

  Fly  1108 VQVLKETLLEDFKLLLKDFYLRIATPEELKRE 1139
            :::.::.:||:.::|.:.    |.:..:||::
 Worm  1031 LRLNRDEILENIQILGQG----IVSDVQLKKQ 1058

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mat89BaNP_650530.2 Nrap 166..1130 CDD:281764 247/1103 (22%)
nol-6NP_493972.3 Nrap 104..1055 CDD:281764 243/1084 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C324267952
eggNOG 1 0.900 E1_KOG2054
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I2545
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D148067at33208
OrthoFinder 1 1.000 FOG0003906
OrthoInspector 1 1.000 T474063
orthoMCL 1 0.900 OOG5_128598
Panther 1 1.100 LDO PTHR17972
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1619
TreeFam 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.