DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8927 and Cpr65Av

Sequence 1:NP_650527.2 Gene:CG8927 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster

Alignment Length:86 Identity:25/87 (29%)
Similarity:34/87 (39%) Gaps:26/87 (30%)


  Fly   261 TIRKWREEN--EDGSITWGYENDDGSFKEEL-----IGTD---CITKGTYGYVDPDGNKREYHYE 315
            ||.::..:|  .|| ..:|||..||..::|.     .|||   ...:|:..:|.|||.....||.
  Fly    32 TILRYDNDNIGTDG-YNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYI 95

  Fly   316 TGIKCDPNNRNNEEELQENGF 336
            .               .||||
  Fly    96 A---------------DENGF 101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8927NP_650527.2 Chitin_bind_4 276..336 CDD:278791 19/68 (28%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:278791 19/70 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.