DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8927 and Cpr65Av

DIOPT Version :9

Sequence 1:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:86 Identity:25/86 - (29%)
Similarity:34/86 - (39%) Gaps:26/86 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 TIRKWREEN--EDGSITWGYENDDGSFKEEL-----IGTD---CITKGTYGYVDPDGNKREYHYE 315
            ||.::..:|  .|| ..:|||..||..::|.     .|||   ...:|:..:|.|||.....||.
  Fly    32 TILRYDNDNIGTDG-YNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYI 95

  Fly   316 TGIKCDPNNRNNEEELQENGF 336
            .               .||||
  Fly    96 A---------------DENGF 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8927NP_650527.2 Chitin_bind_4 276..336 CDD:278791 18/67 (27%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:278791 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.