DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhcl and tpmt

DIOPT Version :9

Sequence 1:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_001016410.1 Gene:tpmt / 549164 XenbaseID:XB-GENE-941707 Length:225 Species:Xenopus tropicalis


Alignment Length:63 Identity:15/63 - (23%)
Similarity:26/63 - (41%) Gaps:16/63 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1539 KKHLEMKLSDAYEEVVEQRQVVGQW-----KRKAQKMTNEMN-----------DLRMLLEEQN 1585
            :|::.:.||:..||:|.:|..:..:     |....|...:|.           .|:...||||
 Frog    19 EKNIHVLLSEFVEEMVNKRAQIRIFFPLCGKAVDMKWLADMGHSIVGVDVSEIGLKEFFEEQN 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492
MYSc 556..1317 CDD:214580
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769 15/62 (24%)
COG1340 1565..1833 CDD:224259 7/32 (22%)
coiled coil 1723..1734 CDD:293879
tpmtNP_001016410.1 AdoMet_MTases 1..222 CDD:302624 15/63 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.