powered by:
Protein Alignment Mhcl and tpmt
DIOPT Version :9
| Sequence 1: | NP_732109.2 |
Gene: | Mhcl / 41955 |
FlyBaseID: | FBgn0026059 |
Length: | 2194 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001016410.1 |
Gene: | tpmt / 549164 |
XenbaseID: | XB-GENE-941707 |
Length: | 225 |
Species: | Xenopus tropicalis |
| Alignment Length: | 63 |
Identity: | 15/63 - (23%) |
| Similarity: | 26/63 - (41%) |
Gaps: | 16/63 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1539 KKHLEMKLSDAYEEVVEQRQVVGQW-----KRKAQKMTNEMN-----------DLRMLLEEQN 1585
:|::.:.||:..||:|.:|..:..: |....|...:|. .|:...||||
Frog 19 EKNIHVLLSEFVEEMVNKRAQIRIFFPLCGKAVDMKWLADMGHSIVGVDVSEIGLKEFFEEQN 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0161 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.