DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhcl and AgaP_AGAP000121

DIOPT Version :9

Sequence 1:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster
Sequence 2:XP_311023.5 Gene:AgaP_AGAP000121 / 1272145 VectorBaseID:AGAP000121 Length:861 Species:Anopheles gambiae


Alignment Length:435 Identity:98/435 - (22%)
Similarity:144/435 - (33%) Gaps:152/435 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GGPGMGGV-----TGVTGSMST------------DELLRL-DEVRRSLKIRGRRKEKEKLPSGIT 78
            ||...||:     :|.|...|.            ||||.| ||....|:.....:|:|.....:.
Mosquito   465 GGYECGGIEPELESGTTFDSSVFALENGTEVASGDELLLLDDEPHAELEQEEEEEEEEDGEELLG 529

  Fly    79 ADY-----------------------SADFFAALNADANGGSNGGAVGAADPEQDRGNEEIVASV 120
            |.|                       :.|..:.....|.|.|.|...|  ||...|.:.|:..|.
Mosquito   530 ARYANGTMGLPPPPPSPPPPIRTSPPTGDSDSCDTRTARGRSAGDEPG--DPTVQRWSREVPHSQ 592

  Fly   121 MTHIESRASNGAGVSVNYS-EVTHSLLSGGLKNR---FLPPIPPKPP--KRGILK-GSRSNMTNV 178
            :...:.|...|.|:|:..: ||     .||::.|   ::..|....|  :.|.|| |......|.
Mosquito   593 IVVADIRKLAGLGISLEGTVEV-----EGGVEVRPHHYIRSILEDGPVGRDGQLKPGDELLQVNE 652

  Fly   179 H--------------EEISFAGSAGGAGGTPEMLLRNTFQNESLYEGAARGAGSIGSNSSQHGTS 229
            |              :|:........|.|:....:.||.:|...:|..:..||.:          
Mosquito   653 HRLQGLKHIEVVKILKELPAQVRVICARGSSPPTVINTSRNAEAFEARSLLAGGL---------- 707

  Fly   230 FTSVESLRSDGEQTGGQQRAMTLPANARYGALPQGNSQGSHLHVLTSPSPSADSLTDTTNSSFAT 294
             .|::||:                     |.|.:..|:.|   :.||   |..:|||...|    
Mosquito   708 -QSLQSLQ---------------------GILTKAQSESS---LYTS---STATLTDQQRS---- 740

  Fly   295 PPFSLSPVGESQGIDRWARVHAFEDVELPLPPVQLVKLPPPRQLVIRRQKSPRQDFGFSLRKAIC 359
                 ..|.:..|:..|.....:.|:|                      |:.| .||||:     
Mosquito   741 -----KSVEQVSGLALWTHEVLYCDIE----------------------KTER-GFGFSI----- 772

  Fly   360 LDRTESL----TSPIFRPVIFAEPGAGGGATG-LLPGDRLIKVNG 399
            ||..:.|    |..:.|.:|   ||.....|. :.|||||:.|||
Mosquito   773 LDYQDPLDTDGTVIVVRGLI---PGGSAETTNFIFPGDRLVSVNG 814

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492 23/66 (35%)
MYSc 556..1317 CDD:214580
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769
COG1340 1565..1833 CDD:224259
coiled coil 1723..1734 CDD:293879
AgaP_AGAP000121XP_311023.5 PDZ_signaling 17..89 CDD:238492
PDZ 264..350 CDD:214570
PDZ 593..682 CDD:214570 19/93 (20%)
PDZ 755..844 CDD:214570 25/91 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.