DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG14259

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:265 Identity:73/265 - (27%)
Similarity:134/265 - (50%) Gaps:18/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TGLLLVLGV-VLHIDWTTAKPPAKKADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPEL 70
            :|||.:|.: .:.:|.:.....|..::: |:||..|....|....|...|.::|..:|..||||:
  Fly    15 SGLLAILCLNEIAMDRSLVSAVAYYSEK-PAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEV 78

  Fly    71 Y--IPAMEPLVVPQVKMDQDSGAI-YLHSVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKL 132
            .  ....:|:.|..:...||:..: .:.:...::.|.|.:...|.|.|:......:...:..||:
  Fly    79 LERFGPFDPMRVRDIVFKQDNNEVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKM 143

  Fly   133 HMESDYSIKVSREGKIMMMPLLGDG--HCKVDLVNITMRTELIGQEYKKNGANFLKINTVKVKYE 195
            .::..|.:    .|:|:::||.|.|  ..::|.::|.:.|::  :.|:|.|..|..:..|:|:..
  Fly   144 RLDGRYEM----AGRILLIPLSGSGKIFIEIDDLDILLLTKI--RLYEKGGFTFDNVTAVQVQLN 202

  Fly   196 LSDVHIHLDNLFNG-DKALGDRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLF----ASF 255
            ||.|..:||||||| .|.:....|||.||||:...|.::||:.:.:.:||...:..:|    |:|
  Fly   203 LSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANF 267

  Fly   256 SYDDL 260
            ..:|:
  Fly   268 FVEDI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 68/243 (28%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 67/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470415
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.