DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10407 and CG14258

Sequence 1:NP_001303466.1 Gene:CG10407 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_651531.1 Gene:CG14258 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster

Alignment Length:251 Identity:66/252 (26%)
Similarity:118/252 (47%) Gaps:15/252 (6%)


  Fly    10 LLVLGVVLHIDWTTAKPPAKKADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPEL-YIP 73
            |.::.|:|     :|...||...:.|.||..|....|:.:.|:.::::....:..:|||.. .:.
  Fly     9 LSIVAVLL-----SAVEGAKYLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWKDGIPGYNAVG 68

  Fly    74 AMEPLVVPQVKMDQD-SGAIYLHSVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESD 137
            :.:|..:.:||..|| |.:|.:::..:.|.|.|..:..|.|...:|:.......::.|||....|
  Fly    69 SFDPFYIKRVKFTQDASRSIAINADLKEVYVAGAGQALVLESSWDPNHYVARTLISVPKLRFNFD 133

  Fly   138 YSIKVSREGKIMMMPLLGDGHCKVDLVNITMRTELIGQEYKKNGANFLKINTVKVKY-ELSDVHI 201
            |.:|    |.:..:.|.|.|....:..|..:..||..:....:...|..:.:|||.: |:....|
  Fly   134 YKVK----GHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGYFADVQSVKVNFREIKQFRI 194

  Fly   202 HLDNLFNGDKALGDRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSY 257
            .|:|||.|:|.|.|..:...||||:...|.:||.:.:.:..:|   :|:...:|.|
  Fly   195 KLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVL---LDRFKKTFVY 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 62/234 (26%)
CG14258NP_651531.1 JHBP 13..255 CDD:284096 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400551
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.