DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10407 and CG11854

Sequence 1:NP_001303466.1 Gene:CG10407 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster

Alignment Length:244 Identity:62/245 (25%)
Similarity:118/245 (48%) Gaps:30/245 (12%)


  Fly    31 ADQLPSFLKVCHRNAPDLDTCVRESYE-ELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYL 94
            |...||.::.|   |...:.|:.:... .||.....||.||.:..::||.|.:.|:.::.     
  Fly    20 ASDFPSGIERC---AIMDEQCLEDRVNFVLRNYAKSGIKELGLIPLDPLHVKKFKIGRNP----- 76

  Fly    95 HSVYRNVKVTGISKHTVNELRLEPSKLKFI------------LSLTFPKLHMESDYSIKVSREGK 147
            ||.. |:   .:|.|.::.|.|.....|.:            |.:..|::.:...||:    :|:
  Fly    77 HSPV-NI---DLSFHEMDILGLHQGVAKRVSGFTRDLSRSIELVMEVPEIGVRGPYSV----DGR 133

  Fly   148 IMMMPLLGDGHCKVDLVNITMRTEL-IGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDK 211
            |:::|:.|:|...:.|....:|.:: :.:..|.:...:.::..:||:.:.|.|...|:|||||.|
  Fly   134 ILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQLENLFNGQK 198

  Fly   212 ALGDRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDDL 260
            .|.:.|:..:|||||.:..|::|.:.:|...|.::.||::|.....:.|
  Fly   199 DLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQL 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 62/245 (25%)
CG11854NP_651358.4 JHBP 21..249 CDD:214779 61/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400227
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.