DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10407 and CG17279

Sequence 1:NP_001303466.1 Gene:CG10407 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster

Alignment Length:241 Identity:59/242 (24%)
Similarity:117/242 (48%) Gaps:19/242 (8%)


  Fly    28 AKKADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAM-----EPLVVPQVKMDQ 87
            |....|||..::.|  .|.| ..|:.|:...:.....:|:|.:.:.|:     |.:||.:::.| 
  Fly    13 APSLGQLPPEIEKC--RAGD-SICIAETVTRILRLYPKGLPSIGLVALDSIGFEDVVVSRLEPD- 73

  Fly    88 DSGAIYLHSVYRNVKVTGISKHTVNELRLEPSKLKFILSLT--FPKLHMESDYSIKVSREGKIMM 150
              |:......:.|:.|.|.:..||.|.:...:.|..:|.|:  .|.|.:...|.::    |.::.
  Fly    74 --GSSTFDLKFPNLTVIGFADSTVTEAKGFDADLPRVLELSGWIPLLKLNGTYEMR----GSLLT 132

  Fly   151 MPLLGDGHCKVDLVNITMRTEL-IGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALG 214
            ||:.|.|..||::....:|.:: :.::.:.:|..:..|:.||...::..:|::|:||||..: :.
  Fly   133 MPIHGKGQAKVEIRECRVRCKVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENLFNNPE-MS 196

  Fly   215 DRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDDL 260
            |.||...|..|..:...:|..:|.|:..::.:.:.::.....||||
  Fly   197 DAMNVVANTKWLEIWHNLRRGITSAVDQLVESILQRVANKLPYDDL 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 59/242 (24%)
CG17279NP_650937.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400726
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.