DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG7079

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:241 Identity:59/241 - (24%)
Similarity:102/241 - (42%) Gaps:21/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDS---GA 91
            :..:||:.:|.||...   ..|:.||...|.....:||||:.:.....|.|....:..||   ||
  Fly    18 QCQKLPAKVKKCHFGD---GKCLVESANALLRDFPKGIPEVDLKPFNVLSVRDWLLVNDSQVGGA 79

  Fly    92 IYLHSVYRNVKVTGISKHTVNELR---LEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPL 153
            .|..::...:.. |....|:.|:|   .:|:..|..:....|:|..:.||   |::...:..:.:
  Fly    80 WYYFNLINQINY-GFENTTITEIRGFDKDPTTTKIEIHGKIPRLVYKGDY---VAKGRMLWFVDI 140

  Fly   154 LGDGHCKVDLVN----ITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALG 214
            ...|..:.|.:|    :|::..:   || :|...:|||..:.....|....:.|||.|..::.|.
  Fly   141 HSQGTSESDFLNFQFVLTLKVRV---EY-RNNKRYLKIYELVPNIRLDRWIMWLDNFFPDNEDLT 201

  Fly   215 DRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDDL 260
            ..:|...|.||.....|:.|.:.:....:..:..:.||....||||
  Fly   202 IAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 59/241 (24%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 59/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.