DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10407 and CG31189

Sequence 1:NP_001303466.1 Gene:CG10407 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster

Alignment Length:237 Identity:61/238 (26%)
Similarity:111/238 (47%) Gaps:17/238 (7%)


  Fly    34 LPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVP-QVKMDQDS-GAIYLHS 96
            ||..::.||...   .||:..|...|.....:||||:.:|.::....| .|.|:..| |.|::..
  Fly    23 LPEDVEKCHFGD---STCLVRSINALIKHYPKGIPEIGLPPLDAYNFPDSVIMESPSRGPIWMDF 84

  Fly    97 VYRNVKVTGISKHTVNELR---LEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGH 158
            ..|:....|.:..|:..:.   .||::.:.:|.:..|:|..|:.|.:    .|::::......|.
  Fly    85 RMRDNVNKGFNNATITHVEGFLYEPNQKQIVLKVRLPRLVHEATYDM----SGRVLLFFFNTTGR 145

  Fly   159 CKVDLVN--ITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFL 221
            ...|..|  ||:..:.: .|| :|...:|||..:....:|....|.||.|:..:..:...||:..
  Fly   146 LISDFQNFRITLTIKAL-VEY-RNDKRYLKIYNLVPSLDLDRWIIWLDGLYKENTDVTIFMNKLF 208

  Fly   222 NENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDDL-LP 262
            ||||.....:::|.:.||..:.....::::|.:.:|||: ||
  Fly   209 NENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMFLP 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 60/236 (25%)
CG31189NP_732580.3 JHBP 9..249 CDD:284096 59/235 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400839
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.