DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG10264

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster


Alignment Length:223 Identity:75/223 - (33%)
Similarity:125/223 - (56%) Gaps:10/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYLHSVYR 99
            ||:|:.|.|:.|:.|.|.|:.:|...|.|..||||:.:.:.|||.:.||.:.:.||.:.|...::
  Fly    45 PSWLQTCKRSNPNEDKCFRQLFEGCFPALAAGIPEIGVKSFEPLNIDQVSVSKGSGNLVLSGGFQ 109

  Fly   100 NVKVTGISKHTVN--ELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCKVD 162
            ::.:.|.|..||.  .|.||...|.|.|.|  |:|.:.:.|::|    |.|:::||:|.|...:.
  Fly   110 DLVIRGPSNATVRRASLDLERRLLNFELEL--PRLRIRAKYNLK----GNILLLPLVGSGDVAMA 168

  Fly   163 LVNI--TMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENW 225
            |.|:  |:.|.:..:...:.|...:.|:.:||.:::..:.|||.|||||::.|...:|.|||:|.
  Fly   169 LKNVHTTVYTRISLRNETRTGDEIIHIDEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNG 233

  Fly   226 KALAEEVRPLMTKALVDILRASVDKLFA 253
            |.:..|:||.:...|.||.....:.:|:
  Fly   234 KEVIAELRPDLELGLADIFHGLWNNVFS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 75/223 (34%)
CG10264NP_650518.1 JHBP 42..270 CDD:214779 75/223 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470423
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.