| Sequence 1: | NP_001303466.1 | Gene: | CG10407 / 41949 | FlyBaseID: | FBgn0038395 | Length: | 263 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650518.1 | Gene: | CG10264 / 41948 | FlyBaseID: | FBgn0038394 | Length: | 270 | Species: | Drosophila melanogaster |
| Alignment Length: | 223 | Identity: | 75/223 - (33%) |
|---|---|---|---|
| Similarity: | 125/223 - (56%) | Gaps: | 10/223 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 35 PSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYLHSVYR 99
Fly 100 NVKVTGISKHTVN--ELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCKVD 162
Fly 163 LVNI--TMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENW 225
Fly 226 KALAEEVRPLMTKALVDILRASVDKLFA 253 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10407 | NP_001303466.1 | JHBP | 28..262 | CDD:284096 | 75/223 (34%) |
| CG10264 | NP_650518.1 | JHBP | 42..270 | CDD:214779 | 75/223 (34%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45470423 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2CDJY | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11008 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.840 | |||||