DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG14661

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster


Alignment Length:233 Identity:65/233 - (27%)
Similarity:115/233 - (49%) Gaps:6/233 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYLH 95
            |..:|.:::|||||.|:|..|::.|...|||.|.:||.||.:|.:|||.:..:.:...|..:.:.
  Fly    20 AGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLYIGDLSILDGSAGLTVK 84

  Fly    96 SVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCK 160
            :  :.:.:.|.|...:.:||......:|...|..|.||.:..|.|    .|.|:.:|:.|:|...
  Fly    85 A--KKLNILGASNFEITKLRASTQNRRFDFELILPHLHGDGLYEI----NGNILALPIKGNGPFT 143

  Fly   161 VDLVNITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENW 225
            .:..|......:.......|...:|.:....:|......::.|:|||||||.|||.:|:.:|:|:
  Fly   144 GNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKLENLFNGDKVLGDVINDTINQNF 208

  Fly   226 KALAEEVRPLMTKALVDILRASVDKLFASFSYDDLLPM 263
            :....::...:.:||.........|:..:|:|.:|.|:
  Fly   209 EVFTNDLIAPIARALEAKFLVITTKILENFTYSELFPV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 64/230 (28%)
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 64/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470316
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26928
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.