DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10407 and CG14661

Sequence 1:NP_001303466.1 Gene:CG10407 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster

Alignment Length:233 Identity:65/234 (28%)
Similarity:115/234 (49%) Gaps:6/234 (3%)


  Fly    31 ADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYLH 95
            |..:|.:::|||||.|:|..|::.|...|||.|.:||.||.:|.:|||.:..:.:...|..:.:.
  Fly    20 AGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLYIGDLSILDGSAGLTVK 84

  Fly    96 SVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCK 160
            :  :.:.:.|.|...:.:||......:|...|..|.||.:..|.|    .|.|:.:|:.|:|...
  Fly    85 A--KKLNILGASNFEITKLRASTQNRRFDFELILPHLHGDGLYEI----NGNILALPIKGNGPFT 143

  Fly   161 VDLVNITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENW 225
            .:..|......:.......|...:|.:....:|......::.|:|||||||.|||.:|:.:|:|:
  Fly   144 GNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKLENLFNGDKVLGDVINDTINQNF 208

  Fly   226 KALAEEVRPLMTKALVDILRASVDKLFASFSYDDLLPM 263
            :....::...:.:||.........|:..:|:|.:|.|:
  Fly   209 EVFTNDLIAPIARALEAKFLVITTKILENFTYSELFPV 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 64/231 (28%)
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 64/231 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1396486
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.