| Sequence 1: | NP_001303466.1 | Gene: | CG10407 / 41949 | FlyBaseID: | FBgn0038395 | Length: | 263 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001246918.1 | Gene: | CG14661 / 40611 | FlyBaseID: | FBgn0037288 | Length: | 246 | Species: | Drosophila melanogaster |
| Alignment Length: | 233 | Identity: | 65/233 - (27%) |
|---|---|---|---|
| Similarity: | 115/233 - (49%) | Gaps: | 6/233 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 31 ADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYLH 95
Fly 96 SVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCK 160
Fly 161 VDLVNITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENW 225
Fly 226 KALAEEVRPLMTKALVDILRASVDKLFASFSYDDLLPM 263 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10407 | NP_001303466.1 | JHBP | 28..262 | CDD:284096 | 64/230 (28%) |
| CG14661 | NP_001246918.1 | JHBP | 10..245 | CDD:399529 | 64/230 (28%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45470316 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2CDJY | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG26928 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11008 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.850 | |||||