DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10407 and CG14457

Sequence 1:NP_001303466.1 Gene:CG10407 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster

Alignment Length:254 Identity:72/255 (28%)
Similarity:132/255 (52%) Gaps:12/255 (5%)


  Fly    15 VVLHIDWTTAKPPAKKA--DQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPEL-YIPAME 76
            :||.:.:||....|:..  .:.|.::|.|.....|...|...|.::|..:|.:|||.| .|.:.:
  Fly     7 IVLLVTFTTCLVRAEDGFLKEPPDYIKECRIADKDFVNCSTHSIQQLFDKLNDGIPGLTSIRSFD 71

  Fly    77 PLVVPQVKMDQ-DSGAIYLHSVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYSI 140
            |..:.::::.| :|.||.|.....|||:.|.....|.:.::......:..:.|.|::.:::|||:
  Fly    72 PFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTFTLPEMKLQADYSL 136

  Fly   141 KVSREGKIMMMPLLGDGHCKVDLVNITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDN 205
                .|:|:::||.|.|...:|..|:|:......:.|.|.|..|..:..:.|.:::..:..:..|
  Fly   137 ----FGRILLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKSYFSN 197

  Fly   206 LFNGDKALGDRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLF----ASFSYDDL 260
            ||||:|.|.|..|:|.|:||:.||:.:..::|:.:.|||...:.|:|    |:|...|:
  Fly   198 LFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIFHFIPANFFVSDI 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 68/242 (28%)
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400341
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.