DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10407 and CG33680

Sequence 1:NP_001303466.1 Gene:CG10407 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster

Alignment Length:231 Identity:55/232 (24%)
Similarity:105/232 (45%) Gaps:49/232 (21%)


  Fly    41 CHRNAPDLDTCVRESYEELRPRLM-----EGIPELYIPAMEPLVVPQVKMDQDSGAIYLHSVYRN 100
            |.||.|.|:.|:..:..::||.|:     :|.|   ...:|||.:..:::...|   ...:|:::
  Fly    38 CARNEPLLERCIINAAYQIRPLLVHGNLGDGFP---TSPLEPLSLDNIELKLSS---QFQAVFKD 96

  Fly   101 VKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCKVDLVN 165
            ::..| ..:|        .|....|:|..|.:            :||..|     .|:|:    |
  Fly    97 LEANG-GNYT--------GKYSLHLNLLLPDI------------KGKGNM-----QGYCE----N 131

  Fly   166 ITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENWKALAE 230
            .....::.|..|.:||.:::|.:.:....:..|..:.|.|||:||:.|||..|..:|.|.:...:
  Fly   132 AKAFVKIRGSRYLRNGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQELYLK 196

  Fly   231 EVRPL----MTKALVDILRASVDKLFASFSYDDLLP 262
            ::.|.    ::|..:|:    .||:.||.::|::.|
  Fly   197 DIAPSLEHGLSKHFLDV----ADKILASATFDEMFP 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 54/230 (23%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 54/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1401503
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.