DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10407 and CG16820

Sequence 1:NP_001303466.1 Gene:CG10407 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster

Alignment Length:275 Identity:57/276 (21%)
Similarity:111/276 (40%) Gaps:46/276 (17%)


  Fly    24 AKPPAKKADQLPSF-----------------------------LKVCHRNAPDLDTCVRESYEEL 59
            :.|..:.|.|.|||                             :..|..|:|||:.|:|...:..
  Fly    42 SSPVEELAAQTPSFSDSHVAVPSSSIDFAVAPASVTLSSGSNEVTPCSLNSPDLNECIRGLIQSF 106

  Fly    60 RPRL-MEGIPELYIPAMEPLVVPQVKMDQDSGAIYLHSVYRNVKVTGISKHTVNELRLEPSKLKF 123
            .|:| .:|:||..:.:::|....:......:..|....:.:|:::.|||:..||.:....:...|
  Fly   107 APKLRYQGVPEFNMDSIDPYFYKRGIFRYTNDGIQGGLLIKNMEIYGISQLQVNSVAANFTDNGF 171

  Fly   124 ILSL--TFPKL----HMESDYSIKVSREGKIMMMPLLGDGHCKVDLVNITMRTELIGQ-EYKKNG 181
            |:.|  ..|:|    |.::|...     |.:.::| .|..:..:|.:..|:.|:  |. |...:|
  Fly   172 IIKLGVELPQLKAGGHFKADVKF-----GGLRLVP-KGPFNITIDNIKATILTD--GHIEQLPSG 228

  Fly   182 ANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENWKALAEEVRPLMTKALVDILRA 246
            ...|.::.:.....:.|..:..:.:|: |:.|...:...:|||...:.....|...:....||.|
  Fly   229 QQRLSLHRLNANVNIGDAKVVANGIFS-DRNLNAMILNLVNENLPEITRVGIPATREQWAPILIA 292

  Fly   247 SVDKLFASFSYDDLL 261
            .:::.||....:..|
  Fly   293 HINEFFAKVPIEKFL 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 56/272 (21%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 51/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1405024
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.