DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG3246

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster


Alignment Length:194 Identity:45/194 - (23%)
Similarity:79/194 - (40%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EGIPELYIPAMEPLVVPQVKMDQDSGAIYLHSVYRNVKVTGISKHTVNELRLEPSKLKFILSLTF 129
            :|:|.  :|..:||.||.||.......:.:    :.||..|:||..::::.|:..:::|...|..
  Fly    66 QGLPG--VPVPDPLEVPNVKKSMGMANLDM----KQVKAYGLSKFRIDKMNLDLKEMRFNGGLQL 124

  Fly   130 PKLHMESDYSIKVSREGKIMMMPLLGDGHCKVDLVNI------TMRTELIGQEYKKNGANFLKIN 188
            .::.::..|::. |...|       .:|...|.|.|:      .:..|..||         |..:
  Fly   125 DQMLVKGQYTLS-SFFSK-------ANGPFTVVLKNVYAEATAFLAVERDGQ---------LATD 172

  Fly   189 TVKVKYELSDVHIHLDNL----------FNG-DKALGDRMNEF-LNENWKALAEEVRPLMTKAL 240
            .:|:....||:.:...||          .|| ...:.|.|..| |.|..|.|..|:..::.|.|
  Fly   173 RIKIDITFSDMTMDFQNLGLVGSVFQSVVNGAPNLVFDAMKPFMLQEADKKLRSEINVMIQKTL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 45/194 (23%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 45/194 (23%)
Grp7_allergen 260..418 CDD:293589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.