DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10407 and CG31207

Sequence 1:NP_001303466.1 Gene:CG10407 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster

Alignment Length:248 Identity:55/249 (22%)
Similarity:97/249 (39%) Gaps:37/249 (15%)


  Fly    34 LPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDS--GAIYL-- 94
            ||..:|.|....   ..|:..|...:.....:|||.:.:..::.:.:...|...|:  ||.:|  
  Fly    22 LPKEIKKCRFGD---SKCIVNSMNAIIKNYPKGIPAIGLKPIDVVDIRDSKFWNDAMVGAFWLNF 83

  Fly    95 ------HSVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPL 153
                  :..:.|..:|.:|....|     |:.....:....|.|..:.||    ...|::.::.:
  Fly    84 DLFNQVNYGFENTTITKVSGFDEN-----PTSSLIEIHGRIPSLIHKGDY----FSMGRVWIVQM 139

  Fly   154 LGDGHCKVDLVNITMRTEL-IGQEYKKNGANFLKINTVKVKYELS-----DVHIH-LDNLFNGDK 211
            ...|....|..|.....:| :..|| :|...:|||      |||:     |..:. |||.|..:.
  Fly   140 NSTGESLSDFQNFRFVLKLKVIMEY-RNNKRYLKI------YELTPFVTMDRWVFWLDNFFESNT 197

  Fly   212 ALGDRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDDL-LPM 263
            .:...:|:..|.:|.....|:.|...|....:.|:..:.:|....|||: ||:
  Fly   198 DMTIAINQVFNLHWVEFWNELEPTNLKIFAGVFRSVFEDIFKKVPYDDMFLPI 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 54/246 (22%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 53/245 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400662
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.