DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG11854

DIOPT Version :8

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster

Alignment Length:264 Identity:66/265 (25%)
Similarity:126/265 (48%) Gaps:34/265 (13%)


  Fly    10 LAVSLSVFGSICLITVTHGAYTREIVNDKLPLQERPSWLQTCKRSNPNEDKCFRQLFEGCFPALA 74
            ||:.| :||  |..|..|.:             :.||.::.|...   :::|............|
  Fly     5 LALVL-LFG--CASTYGHAS-------------DFPSGIERCAIM---DEQCLEDRVNFVLRNYA 50

  Fly    75 -AGIPEIGVKSFEPLNIDQVSVSKGSG---NLVLSGGFQDLVIRGPSNATVRRAS---LDLERRL 132
             :||.|:|:...:||::.:..:.:...   |:.||  |.::.|.|......:|.|   .||.|. 
  Fly    51 KSGIKELGLIPLDPLHVKKFKIGRNPHSPVNIDLS--FHEMDILGLHQGVAKRVSGFTRDLSRS- 112

  Fly   133 LNFELELPRLRIRAKYNLKGNILLLPLVGSG--DVAMALKNVHTTVYTRISLRNETRTGDEIIHI 195
            :...:|:|.:.:|..|::.|.||:||:.|:|  |:.:....|...:..:...:.:.:|..|:::|
  Fly   113 IELVMEVPEIGVRGPYSVDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNI 177

  Fly   196 DEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAELRPDLELGLADIFHGLWNNVF 260
               ||..|...:...|:|||||.:.|:.::::.:|:|.|::..||:|.:......|...:.:.:|
  Fly   178 ---KVELDPSHVTYQLENLFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIF 239

  Fly   261 SKMP 264
            .|:|
  Fly   240 GKLP 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 58/233 (25%)
CG11854NP_651358.4 JHBP 21..249 CDD:214779 58/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1398647
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.