| Sequence 1: | NP_650518.1 | Gene: | CG10264 / 41948 | FlyBaseID: | FBgn0038394 | Length: | 270 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001287436.1 | Gene: | CG7079 / 42488 | FlyBaseID: | FBgn0038849 | Length: | 255 | Species: | Drosophila melanogaster |
| Alignment Length: | 267 | Identity: | 60/267 - (22%) |
|---|---|---|---|
| Similarity: | 105/267 - (39%) | Gaps: | 46/267 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 VSLSVFGSI-CLITVTHGAYTREIVNDKLPLQERPSWLQTCKRSNPNEDKCFRQLFEGCFPALAA 75
Fly 76 GIPEIGVKSFEPLNIDQ---VSVSKGSG-----NLV--LSGGFQDLVIRGPSNATVRRASLDLER 130
Fly 131 RLLNFELELPRLRIRAKYNLKGNIL-LLPLVGSGDVAMALKNVH--TTVYTRISLRNETRTGDEI 192
Fly 193 IHIDEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAELRPDLELGLADIFHGLWN 257
Fly 258 NVFSKMP 264 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10264 | NP_650518.1 | JHBP | 42..270 | CDD:214779 | 54/236 (23%) |
| CG7079 | NP_001287436.1 | JHBP | 20..249 | CDD:214779 | 57/241 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45470386 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11008 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||