DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG33680

DIOPT Version :8

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster

Alignment Length:208 Identity:55/209 (26%)
Similarity:83/209 (40%) Gaps:41/209 (20%)


  Fly    51 CKRSNPNEDKCFRQLFEGCFPALAAGIPEIG----VKSFEPLNIDQVSVSKGSGNLVLSGGFQDL 111
            |.|:.|..::|.........|.|..|  .:|    ....|||::|.:       .|.||..||.:
  Fly    38 CARNEPLLERCIINAAYQIRPLLVHG--NLGDGFPTSPLEPLSLDNI-------ELKLSSQFQAV 93

  Fly   112 VIRGPSNATVRRASLDLERRLLNFELELPRLRIRAKYNLKGNILLLPLVGSGDVAMALKNVHTTV 176
            .             .|||....|:         ..||:|..|:||..:.|.|::....:|....|
  Fly    94 F-------------KDLEANGGNY---------TGKYSLHLNLLLPDIKGKGNMQGYCENAKAFV 136

  Fly   177 YTRIS--LRNETRTGDEIIHIDEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAE 239
            ..|.|  |||    |.:.:...:|....|....::.|.|||:|:..|....||.:|.|.:..:.:
  Fly   137 KIRGSRYLRN----GKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQELYLKD 197

  Fly   240 LRPDLELGLADIF 252
            :.|.||.||:..|
  Fly   198 IAPSLEHGLSKHF 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 55/209 (26%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 55/209 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1401375
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.