DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG5945

DIOPT Version :8

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster

Alignment Length:218 Identity:49/219 (22%)
Similarity:89/219 (41%) Gaps:28/219 (13%)


  Fly    48 LQTCKRSNPNEDKCFRQLFEGCFPALAAGIPEIGVKSFEPLNIDQVSVSKGSGNLVLSGGFQDLV 112
            |..|........:|.:|||....|.|..|.||:.::.:|||::::.|....||.:......::..
  Fly    28 LPKCSTEEDQLGECVKQLFNTLTPRLKDGNPELRIEPYEPLHLNRTSFQYSSGTVNGRITVRNAK 92

  Fly   113 IRGPSNATVRRASLDL--ERRLLNFELELPRLRIRAKYNLKGNILLLPLVGSGDVAMALKNVHTT 175
            |.|.|:...:..|:.|  ::..|....::|:|.|...|.....:..|.|...|:..:.|.:|...
  Fly    93 IYGFSSNRAKEVSVKLNGDKVKLRLVTQMPKLNIVGSYKADMQVNQLQLKPKGEFNVTLLDVEAI 157

  Fly   176 VYTRISLRNETRTGDEIIHIDEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAEL 240
                      |.|..|:...|        |.....|||:.:..:|....|.:    ||  :.|: 
  Fly   158 ----------TVTDGEVYEKD--------GHRFFRLKNIDSKPKIKDLVIKA----NG--IFAD- 197

  Fly   241 RPDLELGLADIFHGLWNNVFSKM 263
             |:|:....::.:..|.:::..|
  Fly   198 -PELDKIALNVANQYWRDIYGIM 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 49/219 (22%)
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 49/219 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1403990
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.