DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG5867

DIOPT Version :8

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster

Alignment Length:278 Identity:67/279 (24%)
Similarity:116/279 (42%) Gaps:56/279 (20%)


  Fly    16 VFGSICLITVTHGAYTREI----VNDKLPLQERPSWLQTCKRSNPNEDKCFRQLFEGCFPALAAG 76
            :||.:.||.:.......||    |..| |::|.|..:.||:..:.|..:|.:|..:...|.:..|
  Fly     4 IFGVVALILMAGLCLAAEIELPPVEFK-PVREIPGDIPTCREGDINISECIKQGLQQITPRMKYG 67

  Fly    77 IPEIGVKSFEPLNIDQVSVSKGSGNLVLSGGFQDLVIRGPSNATVRRASLDLERRLLNFEL--EL 139
            |.|:.:...:|..:.:.|.|..||.|......:::||.|.|...|.:.:..|:...:..|:  .:
  Fly    68 ISELNIPPLDPFEMGKSSYSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRVRMEILSHV 132

  Fly   140 PRLRIRAKY--NLKGNILLLPLVGS-----GDVAMALKNV--------HTTVYTRIS-LRNETRT 188
            |::.:...|  ::|.|.|.|...|:     .||||..:.:        ||  |.|:: |..|.:.
  Fly   133 PQMFVEGLYKADIKLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHT--YLRLTKLETEPKV 195

  Fly   189 GDEIIHIDEMKVGFDVGAMRIHLKNLFNG---NEILAASINSFLNQNGKEVIAELRPDLELGLAD 250
            ||                    ||...||   :.:|...|..|:||..:::...:.|:    ..|
  Fly   196 GD--------------------LKFYANGLVPDPVLNDVILDFINQYWRQLYQAMLPE----TLD 236

  Fly   251 IFHGL----WNNVFSKMP 264
            .:..|    .|:.|:.:|
  Fly   237 TWQPLILKSTNDFFAALP 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 58/249 (23%)
CG5867NP_609625.2 JHBP 34..260 CDD:214779 58/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1405436
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.