DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG31207

DIOPT Version :9

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 / 326125 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster


Alignment Length:230 Identity:52/230 - (22%)
Similarity:93/230 - (40%) Gaps:20/230 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PSWLQTCKRSNPNEDKCFRQLFEGCFPALAAGIPEIGVKSFEPLNIDQVSVSKGSGNLVLSGGFQ 109
            |..::.|:.   .:.||..............|||.||:|   |:::..:..|| ..|..:.|.|.
  Fly    23 PKEIKKCRF---GDSKCIVNSMNAIIKNYPKGIPAIGLK---PIDVVDIRDSK-FWNDAMVGAFW 80

  Fly   110 ---DL---VIRGPSNATVRRASLDLER---RLLNFELELPRLRIRAKYNLKGNILLLPLVGSGDV 165
               ||   |..|..|.|:.:.|...|.   .|:.....:|.|..:..|...|.:.::.:..:|:.
  Fly    81 LNFDLFNQVNYGFENTTITKVSGFDENPTSSLIEIHGRIPSLIHKGDYFSMGRVWIVQMNSTGES 145

  Fly   166 AMALKNVHTTVYTRISLRNETRTGDEIIHIDEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLN 230
            ....:|....:..::.:  |.|.....:.|.|:.....:......|.|.|..|..:..:||...|
  Fly   146 LSDFQNFRFVLKLKVIM--EYRNNKRYLKIYELTPFVTMDRWVFWLDNFFESNTDMTIAINQVFN 208

  Fly   231 QNGKEVIAELRP-DLELGLADIFHGLWNNVFSKMP 264
            .:..|...||.| :|:: .|.:|..::.::|.|:|
  Fly   209 LHWVEFWNELEPTNLKI-FAGVFRSVFEDIFKKVP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 52/230 (23%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 52/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.